SAR1B (NM_001033503) Human Recombinant Protein

SKU
TP313692
Recombinant protein of human SAR1 homolog B (S. cerevisiae) (SAR1B), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC213692 protein sequence
Red=Cloning site Green=Tags(s)

MSFIFDWIYSGFSSVLQFLGLYKKTGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSEELTIAGMT
FTTFDLGGHVQARRVWKNYLPAINGIVFLVDCADHERLLESKEELDSLMTDETIANVPILILGNKIDRPE
AISEERLREMFGLYGQTTGKGSISLKELNARPLEVFMCSVLKRQGYGEGFRWMAQYID

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 22.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001028675
Locus ID 51128
UniProt ID Q9Y6B6
Cytogenetics 5q31.1
RefSeq Size 6651
RefSeq ORF 594
Synonyms ANDD; CMRD; GTBPB; SARA2
Summary The protein encoded by this gene is a small GTPase that acts as a homodimer. The encoded protein is activated by the guanine nucleotide exchange factor PREB and is involved in protein transport from the endoplasmic reticulum to the Golgi. This protein is part of the COPII coat complex. Defects in this gene are a cause of chylomicron retention disease (CMRD), also known as Anderson disease (ANDD). Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Mar 2010]
Write Your Own Review
You're reviewing:SAR1B (NM_001033503) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH310593 SAR1B MS Standard C13 and N15-labeled recombinant protein (NP_057187) 10 ug
$3,255.00
PH313692 SAR1B MS Standard C13 and N15-labeled recombinant protein (NP_001028675) 10 ug
$3,255.00
LC402500 SAR1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422370 SAR1B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402500 Transient overexpression lysate of SAR1 homolog B (S. cerevisiae) (SAR1B), transcript variant 2 100 ug
$436.00
LY422370 Transient overexpression lysate of SAR1 homolog B (S. cerevisiae) (SAR1B), transcript variant 1 100 ug
$436.00
TP310593 Recombinant protein of human SAR1 homolog B (S. cerevisiae) (SAR1B), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.