SAR1B (NM_016103) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC210593] |
Predicted MW | 22.4 kDa |
Protein Sequence |
Protein Sequence
>RC210593 protein sequence
Red=Cloning site Green=Tags(s) MSFIFDWIYSGFSSVLQFLGLYKKTGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSEELTIAGMT FTTFDLGGHVQARRVWKNYLPAINGIVFLVDCADHERLLESKEELDSLMTDETIANVPILILGNKIDRPE AISEERLREMFGLYGQTTGKGSISLKELNARPLEVFMCSVLKRQGYGEGFRWMAQYID myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_057187 |
RefSeq Size | 6532 |
RefSeq ORF | 594 |
Synonyms | ANDD; CMRD; GTBPB; SARA2 |
Locus ID | 51128 |
UniProt ID | Q9Y6B6 |
Cytogenetics | 5q31.1 |
Summary | The protein encoded by this gene is a small GTPase that acts as a homodimer. The encoded protein is activated by the guanine nucleotide exchange factor PREB and is involved in protein transport from the endoplasmic reticulum to the Golgi. This protein is part of the COPII coat complex. Defects in this gene are a cause of chylomicron retention disease (CMRD), also known as Anderson disease (ANDD). Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Mar 2010] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH313692 | SAR1B MS Standard C13 and N15-labeled recombinant protein (NP_001028675) | 10 ug |
$3,255.00
|
|
LC402500 | SAR1B HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC422370 | SAR1B HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY402500 | Transient overexpression lysate of SAR1 homolog B (S. cerevisiae) (SAR1B), transcript variant 2 | 100 ug |
$436.00
|
|
LY422370 | Transient overexpression lysate of SAR1 homolog B (S. cerevisiae) (SAR1B), transcript variant 1 | 100 ug |
$436.00
|
|
TP310593 | Recombinant protein of human SAR1 homolog B (S. cerevisiae) (SAR1B), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP313692 | Recombinant protein of human SAR1 homolog B (S. cerevisiae) (SAR1B), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.