OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ICAM2 (NM_001099789) Human Mass Spec Standard

Be the first to review this product
SKU
PH312775
ICAM2 MS Standard C13 and N15-labeled recombinant protein (NP_001093259)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA308279 Rabbit Polyclonal antibody to ICAM2 (intercellular adhesion molecule 2)
100 ul
$665.00
LY424476 Transient overexpression lysate of intercellular adhesion molecule 2 (ICAM2), transcript variant 5 (as WB positive control) 100 ug
$436.00

Other products for "ICAM2 or NM_001099789"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC212775
Predicted MW 30.7 kDa
Protein Sequence
Protein Sequence
>RC212775 protein sequence
Red=Cloning site Green=Tags(s)

MSSFGYRTLTVALFTLICCPGSDEKVFEVHVRPKKLAVEPKGSLEVNCSTTCNQPEVGGLETSLDKILLD
EQAQWKHYLVSNISHDTVLQCHFTCSGKQESMNSNVSVYQPPRQVILTLQPTLVAVGKSFTIECRVPTVE
PLDSLTLFLFRGNETLHYETFGKAAPAPQEATATFNSTADREDGHRNFSCLAVLDLMSRGGNIFHKHSAP
KMLEIYEPVSDSQMVIIVTVVSVLLSLFVTSVLLCFIFGQHLRQQRMGTYGVRAAWRRLPQAFRP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001093259
RefSeq Size 1153
RefSeq ORF 825
Synonyms CD102
Locus ID 3384
UniProt ID P13598
Cytogenetics 17q23.3
Summary The protein encoded by this gene is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin-like C2-type domains, and bind to the leukocyte adhesion LFA-1 protein. This protein may play a role in lymphocyte recirculation by blocking LFA-1-dependent cell adhesion. It mediates adhesive interactions important for antigen-specific immune response, NK-cell mediated clearance, lymphocyte recirculation, and other cellular interactions important for immune response and surveillance. Several transcript variants encoding the same protein have been found for this gene. provided by RefSeq, Jul 2008
Protein Families ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), Natural killer cell mediated cytotoxicity
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ICAM2" proteins (19)
SKU Description Size Price
PH300459 ICAM2 MS Standard C13 and N15-labeled recombinant protein (NP_000864) 10 ug
$3,360.00
PH312720 ICAM2 MS Standard C13 and N15-labeled recombinant protein (NP_001093257) 10 ug
$3,360.00
PH316706 ICAM2 MS Standard C13 and N15-labeled recombinant protein (NP_001093258) 10 ug
$3,360.00
LC420535 Lyophilized ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420536 Lyophilized ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420537 Lyophilized ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420538 Lyophilized ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424476 Lyophilized ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426090 Lyophilized ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY420535 Transient overexpression lysate of intercellular adhesion molecule 2 (ICAM2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY420536 Transient overexpression lysate of intercellular adhesion molecule 2 (ICAM2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY420537 Transient overexpression lysate of intercellular adhesion molecule 2 (ICAM2), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY420538 Transient overexpression lysate of intercellular adhesion molecule 2 (ICAM2), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY424476 Transient overexpression lysate of intercellular adhesion molecule 2 (ICAM2), transcript variant 5 (as WB positive control) 100 ug
$436.00
TP300459 Recombinant protein of human intercellular adhesion molecule 2 (ICAM2), transcript variant 5, 20 µg 20 ug
$867.00
TP312720 Purified recombinant protein of Homo sapiens intercellular adhesion molecule 2 (ICAM2), transcript variant 2, 20 µg 20 ug
$867.00
TP312775 Purified recombinant protein of Homo sapiens intercellular adhesion molecule 2 (ICAM2), transcript variant 4, 20 µg 20 ug
$867.00
TP316706 Purified recombinant protein of Homo sapiens intercellular adhesion molecule 2 (ICAM2), transcript variant 3, 20 µg 20 ug
$867.00
TP720626 Purified recombinant protein of Human intercellular adhesion molecule 2 (ICAM2), transcript variant 5 10 ug
$190.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products