ICAM2 (NM_001099789) Human Recombinant Protein

SKU
TP312775
Purified recombinant protein of Homo sapiens intercellular adhesion molecule 2 (ICAM2), transcript variant 4, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC212775 protein sequence
Red=Cloning site Green=Tags(s)

MSSFGYRTLTVALFTLICCPGSDEKVFEVHVRPKKLAVEPKGSLEVNCSTTCNQPEVGGLETSLDKILLD
EQAQWKHYLVSNISHDTVLQCHFTCSGKQESMNSNVSVYQPPRQVILTLQPTLVAVGKSFTIECRVPTVE
PLDSLTLFLFRGNETLHYETFGKAAPAPQEATATFNSTADREDGHRNFSCLAVLDLMSRGGNIFHKHSAP
KMLEIYEPVSDSQMVIIVTVVSVLLSLFVTSVLLCFIFGQHLRQQRMGTYGVRAAWRRLPQAFRP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 28.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001093259
Locus ID 3384
UniProt ID P13598
Cytogenetics 17q23.3
RefSeq Size 1153
RefSeq ORF 825
Synonyms CD102
Summary The protein encoded by this gene is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin-like C2-type domains, and bind to the leukocyte adhesion LFA-1 protein. This protein may play a role in lymphocyte recirculation by blocking LFA-1-dependent cell adhesion. It mediates adhesive interactions important for antigen-specific immune response, NK-cell mediated clearance, lymphocyte recirculation, and other cellular interactions important for immune response and surveillance. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), Natural killer cell mediated cytotoxicity
Write Your Own Review
You're reviewing:ICAM2 (NM_001099789) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300459 ICAM2 MS Standard C13 and N15-labeled recombinant protein (NP_000864) 10 ug
$3,255.00
PH312720 ICAM2 MS Standard C13 and N15-labeled recombinant protein (NP_001093257) 10 ug
$3,255.00
PH312775 ICAM2 MS Standard C13 and N15-labeled recombinant protein (NP_001093259) 10 ug
$3,255.00
PH316706 ICAM2 MS Standard C13 and N15-labeled recombinant protein (NP_001093258) 10 ug
$3,255.00
LC420535 ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420536 ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420537 ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420538 ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424476 ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426090 ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426091 ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY420535 Transient overexpression lysate of intercellular adhesion molecule 2 (ICAM2), transcript variant 1 100 ug
$436.00
LY420536 Transient overexpression lysate of intercellular adhesion molecule 2 (ICAM2), transcript variant 2 100 ug
$436.00
LY420537 Transient overexpression lysate of intercellular adhesion molecule 2 (ICAM2), transcript variant 3 100 ug
$436.00
LY420538 Transient overexpression lysate of intercellular adhesion molecule 2 (ICAM2), transcript variant 4 100 ug
$436.00
LY424476 Transient overexpression lysate of intercellular adhesion molecule 2 (ICAM2), transcript variant 5 100 ug
$436.00
TP300459 Recombinant protein of human intercellular adhesion molecule 2 (ICAM2), transcript variant 5, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP312720 Purified recombinant protein of Homo sapiens intercellular adhesion molecule 2 (ICAM2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP316706 Purified recombinant protein of Homo sapiens intercellular adhesion molecule 2 (ICAM2), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720626 Purified recombinant protein of Human intercellular adhesion molecule 2 (ICAM2), transcript variant 5 10 ug
$185.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.