ICAM2 (NM_001099789) Human Mass Spec Standard

SKU
PH312775
ICAM2 MS Standard C13 and N15-labeled recombinant protein (NP_001093259)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212775]
Predicted MW 30.7 kDa
Protein Sequence
Protein Sequence
>RC212775 protein sequence
Red=Cloning site Green=Tags(s)

MSSFGYRTLTVALFTLICCPGSDEKVFEVHVRPKKLAVEPKGSLEVNCSTTCNQPEVGGLETSLDKILLD
EQAQWKHYLVSNISHDTVLQCHFTCSGKQESMNSNVSVYQPPRQVILTLQPTLVAVGKSFTIECRVPTVE
PLDSLTLFLFRGNETLHYETFGKAAPAPQEATATFNSTADREDGHRNFSCLAVLDLMSRGGNIFHKHSAP
KMLEIYEPVSDSQMVIIVTVVSVLLSLFVTSVLLCFIFGQHLRQQRMGTYGVRAAWRRLPQAFRP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001093259
RefSeq Size 1153
RefSeq ORF 825
Synonyms CD102
Locus ID 3384
UniProt ID P13598
Cytogenetics 17q23.3
Summary The protein encoded by this gene is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin-like C2-type domains, and bind to the leukocyte adhesion LFA-1 protein. This protein may play a role in lymphocyte recirculation by blocking LFA-1-dependent cell adhesion. It mediates adhesive interactions important for antigen-specific immune response, NK-cell mediated clearance, lymphocyte recirculation, and other cellular interactions important for immune response and surveillance. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), Natural killer cell mediated cytotoxicity
Write Your Own Review
You're reviewing:ICAM2 (NM_001099789) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH300459 ICAM2 MS Standard C13 and N15-labeled recombinant protein (NP_000864) 10 ug
$3,255.00
PH312720 ICAM2 MS Standard C13 and N15-labeled recombinant protein (NP_001093257) 10 ug
$3,255.00
PH316706 ICAM2 MS Standard C13 and N15-labeled recombinant protein (NP_001093258) 10 ug
$3,255.00
LC420535 ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420536 ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420537 ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420538 ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424476 ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426090 ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426091 ICAM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY420535 Transient overexpression lysate of intercellular adhesion molecule 2 (ICAM2), transcript variant 1 100 ug
$436.00
LY420536 Transient overexpression lysate of intercellular adhesion molecule 2 (ICAM2), transcript variant 2 100 ug
$436.00
LY420537 Transient overexpression lysate of intercellular adhesion molecule 2 (ICAM2), transcript variant 3 100 ug
$436.00
LY420538 Transient overexpression lysate of intercellular adhesion molecule 2 (ICAM2), transcript variant 4 100 ug
$436.00
LY424476 Transient overexpression lysate of intercellular adhesion molecule 2 (ICAM2), transcript variant 5 100 ug
$436.00
TP300459 Recombinant protein of human intercellular adhesion molecule 2 (ICAM2), transcript variant 5, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP312720 Purified recombinant protein of Homo sapiens intercellular adhesion molecule 2 (ICAM2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP312775 Purified recombinant protein of Homo sapiens intercellular adhesion molecule 2 (ICAM2), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP316706 Purified recombinant protein of Homo sapiens intercellular adhesion molecule 2 (ICAM2), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720626 Purified recombinant protein of Human intercellular adhesion molecule 2 (ICAM2), transcript variant 5 10 ug
$185.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.