TPPP3 (NM_015964) Human Mass Spec Standard

CAT#: PH312586

TPPP3 MS Standard C13 and N15-labeled recombinant protein (NP_057048)

Product Images

Coomassie blue staining of purified TPPP3 protein (Cat# TP312586). The protein was produced from HEK293T cells transfected with TPPP3 cDNA clone (Cat# RC212586) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212586
• Predicted MW: 18.8 kDa
• Protein Sequence:
  Sequence Link

  >RC212586 representing NM_015964
  Red=Cloning site Green=Tags(s)
  
  MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVI
  NYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFD
  ESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057048
• RefSeq Size: 1055
• RefSeq ORF: 528
• Synonyms: CGI-38; p20; p25gamma; TPPP/p20
• Locus ID: 51673
• UniProt ID: Q9BW30, A0A024R702
• Cytogenetics: 16q22.1
• Summary: Binds tubulin and has microtubule bundling activity. May play a role in cell proliferation and mitosis.[UniProtKB/Swiss-Prot Function]