OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TPPP3 (NM_016140) Human Mass Spec Standard

Be the first to review this product
SKU
PH300020
TPPP3 MS Standard C13 and N15-labeled recombinant protein (NP_057224)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA382762 TPPP3 Rabbit polyclonal Antibody
100 ul
$410.00
LY414167 Transient overexpression lysate of tubulin polymerization-promoting protein family member 3 (TPPP3) (as WB positive control) 100 ug
$436.00

Other products for "TPPP3 or NM_016140"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200020
Predicted MW 19 kDa
Protein Sequence
Protein Sequence
>RC200020 protein sequence
Red=Cloning site Green=Tags(s)

MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVI
NYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFD
ESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057224
RefSeq Size 1159
RefSeq ORF 528
Synonyms CGI-38; p20; p25gamma; TPPP/p20
Locus ID 51673
UniProt ID Q9BW30
Cytogenetics 16q22.1
Summary Binds tubulin and has microtubule bundling activity. May play a role in cell proliferation and mitosis.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TPPP3" proteins (7)
SKU Description Size Price
PH312586 TPPP3 MS Standard C13 and N15-labeled recombinant protein (NP_057048) 10 ug
$3,360.00
LC414167 Lyophilized TPPP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC414281 Lyophilized TPPP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414167 Transient overexpression lysate of tubulin polymerization-promoting protein family member 3 (TPPP3) (as WB positive control) 100 ug
$436.00
LY414281 Transient overexpression lysate of tubulin polymerization-promoting protein family member 3 (TPPP3) (as WB positive control) 100 ug
$436.00
TP300020 Recombinant protein of human tubulin polymerization-promoting protein family member 3 (TPPP3), 20 µg 20 ug
$867.00
TP312586 Recombinant protein of human tubulin polymerization-promoting protein family member 3 (TPPP3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products