TPPP3 (NM_015964) Human Mass Spec Standard

SKU
PH312586
TPPP3 MS Standard C13 and N15-labeled recombinant protein (NP_057048)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212586]
Predicted MW 18.8 kDa
Protein Sequence
Protein Sequence
>RC212586 representing NM_015964
Red=Cloning site Green=Tags(s)

MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVI
NYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFD
ESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057048
RefSeq Size 1055
RefSeq ORF 528
Synonyms CGI-38; p20; p25gamma; TPPP/p20
Locus ID 51673
UniProt ID Q9BW30
Cytogenetics 16q22.1
Summary Binds tubulin and has microtubule bundling activity. May play a role in cell proliferation and mitosis.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:TPPP3 (NM_015964) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH300020 TPPP3 MS Standard C13 and N15-labeled recombinant protein (NP_057224) 10 ug
$3,255.00
LC414167 TPPP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC414281 TPPP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414167 Transient overexpression lysate of tubulin polymerization-promoting protein family member 3 (TPPP3) 100 ug
$436.00
LY414281 Transient overexpression lysate of tubulin polymerization-promoting protein family member 3 (TPPP3) 100 ug
$436.00
TP300020 Recombinant protein of human tubulin polymerization-promoting protein family member 3 (TPPP3), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP312586 Recombinant protein of human tubulin polymerization-promoting protein family member 3 (TPPP3), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.