TPPP3 (NM_015964) Human Recombinant Protein

SKU TP312586

Recombinant protein of human tubulin polymerization-promoting protein family member 3 (TPPP3), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC212586 representing NM_015964; Red=Cloning site Green=Tags(s); ; MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVI; NYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFD; ESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 18.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_057048
• Locus ID: 51673
• UniProt ID: Q9BW30
• Cytogenetics: 16q22.1
• RefSeq Size: 1055
• RefSeq ORF: 528
• Synonyms: CGI-38; p20; p25gamma; TPPP/p20
• Summary: Binds tubulin and has microtubule bundling activity. May play a role in cell proliferation and mitosis.[UniProtKB/Swiss-Prot Function]