TPPP3 (NM_015964) Human Recombinant Protein

SKU
TP312586
Recombinant protein of human tubulin polymerization-promoting protein family member 3 (TPPP3), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC212586 representing NM_015964
Red=Cloning site Green=Tags(s)

MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVI
NYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFD
ESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK

TRTRPLEQKLISEEDLAANDILDYKDDDDKV
Tag C-Myc/DDK
Predicted MW 18.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_057048
Locus ID 51673
UniProt ID Q9BW30
Cytogenetics 16q22.1
RefSeq Size 1055
RefSeq ORF 528
Synonyms CGI-38; p20; p25gamma; TPPP/p20
Summary Binds tubulin and has microtubule bundling activity. May play a role in cell proliferation and mitosis.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:TPPP3 (NM_015964) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300020 TPPP3 MS Standard C13 and N15-labeled recombinant protein (NP_057224) 10 ug
$3,255.00
PH312586 TPPP3 MS Standard C13 and N15-labeled recombinant protein (NP_057048) 10 ug
$3,255.00
LC414167 TPPP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC414281 TPPP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414167 Transient overexpression lysate of tubulin polymerization-promoting protein family member 3 (TPPP3) 100 ug
$436.00
LY414281 Transient overexpression lysate of tubulin polymerization-promoting protein family member 3 (TPPP3) 100 ug
$436.00
TP300020 Recombinant protein of human tubulin polymerization-promoting protein family member 3 (TPPP3), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.