OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HSP90AA1 (NM_005348) Human Mass Spec Standard

Be the first to review this product
SKU
PH312496
HSP90AA1 MS Standard C13 and N15-labeled recombinant protein (NP_005339)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA500883 Anti-HSP90AA1 (Hsp90 alpha) mouse monoclonal antibody, clone OTI3B5 (formerly 3B5) 100 ul
$447.00
LY400399 Transient overexpression lysate of heat shock protein 90kDa alpha (cytosolic), class A member 1 (HSP90AA1), transcript variant 1 (as WB positive control) 100 ug
$665.00

Other products for "HSP90AA1 or NM_005348"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC212496
Predicted MW 84.5 kDa
Protein Sequence
Protein Sequence
>RC212496 representing NM_005348
Red=Cloning site Green=Tags(s)

MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKL
DSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYS
AYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKH
SQFIGYPITLFVEKERDKEVSDDEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKI
KEKYIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFD
LFENRKKKNNIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKC
LELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQKH
IYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLELPEDEEEKKK
QEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAA
KKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDE
DDPTADDTSAAVTEEMPPLEGDDDTSRMEEVD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005339
RefSeq Size 2912
RefSeq ORF 2196
Synonyms EL52; HEL-S-65p; HSP86; Hsp89; HSP89A; Hsp90; HSP90A; HSP90N; Hsp103; HSPC1; HSPCA; HSPCAL1; HSPCAL4; HSPN; LAP-2; LAP2
Locus ID 3320
UniProt ID P07900
Cytogenetics 14q32.31
Summary The protein encoded by this gene is an inducible molecular chaperone that functions as a homodimer. The encoded protein aids in the proper folding of specific target proteins by use of an ATPase activity that is modulated by co-chaperones. Two transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jan 2012
Protein Families Druggable Genome
Protein Pathways Antigen processing and presentation, NOD-like receptor signaling pathway, Pathways in cancer, Progesterone-mediated oocyte maturation, Prostate cancer
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HSP90AA1" proteins (7)
SKU Description Size Price
PH318420 HSP90AA1 MS Standard C13 and N15-labeled recombinant protein (NP_001017963) 10 ug
$3,360.00
LC400399 Lyophilized HSP90AA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC417365 Lyophilized HSP90AA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400399 Transient overexpression lysate of heat shock protein 90kDa alpha (cytosolic), class A member 1 (HSP90AA1), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY417365 Transient overexpression lysate of heat shock protein 90kDa alpha (cytosolic), class A member 1 (HSP90AA1), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP312496 Recombinant protein of human heat shock protein 90kDa alpha (cytosolic), class A member 1 (HSP90AA1), transcript variant 2, 20 µg 20 ug
$737.00
TP318420 Recombinant protein of human heat shock protein 90kDa alpha (cytosolic), class A member 1 (HSP90AA1), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products