OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PID1 (NM_017933) Human Mass Spec Standard

Be the first to review this product
SKU
PH312451
PID1 MS Standard C13 and N15-labeled recombinant protein (NP_060403)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA379913 PID1 Rabbit polyclonal Antibody
100 ul
$410.00
LY402631 Transient overexpression lysate of phosphotyrosine interaction domain containing 1 (PID1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "PID1 or NM_017933"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC212451
Predicted MW 27.9 kDa
Protein Sequence
Protein Sequence
>RC212451 representing NM_017933
Red=Cloning site Green=Tags(s)

MPRIAGNHLMLEESRTCSSPELLDGVWPCQPLHFGLPASEMHFQTMLKSKLNVLTLKKEPLPAVIFHEPE
AIELCTTTPLMKTRTHSGCKVTYLGKVSTTGMQFLSGCTEKPVIELWKKHTLAREDVFPANALLEIRPFQ
VWLHHLDHKGEATVHMDTFQVARIAYCTADHNVSPNIFAWVYREINDDLSYQMDCHAVECESKLEAKKLA
HAMMEAFRKTFHSMKSDGRIHSNSSSEEVSQELESDDG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060403
RefSeq Size 2745
RefSeq ORF 744
Synonyms HMFN2073; NYGGF4; P-CLI1; PCLI1
Locus ID 55022
UniProt ID Q7Z2X4
Cytogenetics 2q36.3
Summary Increases proliferation of preadipocytes without affecting adipocytic differentiation.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PID1" proteins (7)
SKU Description Size Price
PH312505 PID1 MS Standard C13 and N15-labeled recombinant protein (NP_001094288) 10 ug
$3,360.00
LC402631 Lyophilized PID1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420294 Lyophilized PID1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402631 Transient overexpression lysate of phosphotyrosine interaction domain containing 1 (PID1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY420294 Transient overexpression lysate of phosphotyrosine interaction domain containing 1 (PID1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP312451 Recombinant protein of human phosphotyrosine interaction domain containing 1 (PID1), transcript variant 1, 20 µg 20 ug
$867.00
TP312505 Purified recombinant protein of Homo sapiens phosphotyrosine interaction domain containing 1 (PID1), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products