PID1 (NM_001100818) Human Recombinant Protein

SKU
TP312505
Purified recombinant protein of Homo sapiens phosphotyrosine interaction domain containing 1 (PID1), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC212505 representing NM_001100818
Red=Cloning site Green=Tags(s)

MWQPATERLQHFQTMLKSKLNVLTLKKEPLPAVIFHEPEAIELCTTTPLMKTRTHSGCKVTYLGKVSTTG
MQFLSGCTEKPVIELWKKHTLAREDVFPANALLEIRPFQVWLHHLDHKGEATVHMDTFQVARIAYCTADH
NVSPNIFAWVYREINDDLSYQMDCHAVECESKLEAKKLAHAMMEAFRKTFHSMKSDGRIHSNSSSEEVSQ
ELESDDG

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 24.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001094288
Locus ID 55022
UniProt ID Q7Z2X4
Cytogenetics 2q36.3
RefSeq Size 2626
RefSeq ORF 651
Synonyms HMFN2073; NYGGF4; P-CLI1; PCLI1
Summary Increases proliferation of preadipocytes without affecting adipocytic differentiation.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:PID1 (NM_001100818) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH312451 PID1 MS Standard C13 and N15-labeled recombinant protein (NP_060403) 10 ug
$3,255.00
PH312505 PID1 MS Standard C13 and N15-labeled recombinant protein (NP_001094288) 10 ug
$3,255.00
LC402631 PID1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420294 PID1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402631 Transient overexpression lysate of phosphotyrosine interaction domain containing 1 (PID1), transcript variant 1 100 ug
$436.00
LY420294 Transient overexpression lysate of phosphotyrosine interaction domain containing 1 (PID1), transcript variant 2 100 ug
$436.00
TP312451 Recombinant protein of human phosphotyrosine interaction domain containing 1 (PID1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.