PID1 (NM_001100818) Human Mass Spec Standard

SKU
PH312505
PID1 MS Standard C13 and N15-labeled recombinant protein (NP_001094288)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212505]
Predicted MW 24.6 kDa
Protein Sequence
Protein Sequence
>RC212505 representing NM_001100818
Red=Cloning site Green=Tags(s)

MWQPATERLQHFQTMLKSKLNVLTLKKEPLPAVIFHEPEAIELCTTTPLMKTRTHSGCKVTYLGKVSTTG
MQFLSGCTEKPVIELWKKHTLAREDVFPANALLEIRPFQVWLHHLDHKGEATVHMDTFQVARIAYCTADH
NVSPNIFAWVYREINDDLSYQMDCHAVECESKLEAKKLAHAMMEAFRKTFHSMKSDGRIHSNSSSEEVSQ
ELESDDG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001094288
RefSeq Size 2626
RefSeq ORF 651
Synonyms HMFN2073; NYGGF4; P-CLI1; PCLI1
Locus ID 55022
UniProt ID Q7Z2X4
Cytogenetics 2q36.3
Summary Increases proliferation of preadipocytes without affecting adipocytic differentiation.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:PID1 (NM_001100818) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH312451 PID1 MS Standard C13 and N15-labeled recombinant protein (NP_060403) 10 ug
$3,255.00
LC402631 PID1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420294 PID1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402631 Transient overexpression lysate of phosphotyrosine interaction domain containing 1 (PID1), transcript variant 1 100 ug
$436.00
LY420294 Transient overexpression lysate of phosphotyrosine interaction domain containing 1 (PID1), transcript variant 2 100 ug
$436.00
TP312451 Recombinant protein of human phosphotyrosine interaction domain containing 1 (PID1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP312505 Purified recombinant protein of Homo sapiens phosphotyrosine interaction domain containing 1 (PID1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.