OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

INPP4A (NM_004027) Human Mass Spec Standard

Be the first to review this product
SKU
PH311900
INPP4A MS Standard C13 and N15-labeled recombinant protein (NP_004018)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA366080 INPP4A rabbit polyclonal antibody
100 ul
$310.00
LY418285 Transient overexpression lysate of inositol polyphosphate-4-phosphatase, type I, 107kDa (INPP4A), transcript variant a (as WB positive control) 100 ug
$665.00

Other products for "INPP4A or NM_004027"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211900
Predicted MW 105.5 kDa
Protein Sequence
Protein Sequence
>RC211900 representing NM_004027
Red=Cloning site Green=Tags(s)

MTAREHSPRHGARARAMQRASTIDVAADMLGLSLAGNIQDPDEPILEFSLACSELHTPSLDRKPNSFVAV
SVTTPPQAFWTKHAQTEIIEGTNNPIFLSSIAFFQDSLINQMTQVKLSVYDVKDRSQGTMYLLGSGTFIV
KDLLQDRHHRLHLTLRSAESDRVGNITVIGWQMEEKSDQRPPVTRSVDTVNGRMVLPVDESLTEALGIRS
KYASLRKDTLLKSVFGGAICRMYRFPTTDGNHLRILEQMAESVLSLHVPRQFVKLLLEEDAARVCELEEL
GELSPCWESLRRQIVTQYQTIILTYQENLTDLHQYRGPSFKASSLKADKKLEFVPTNLHIQRMRVQDDGG
SDQNYDIVTIGAPAAHCQGFKSGGLRKKLHKFEETKKHFEECCTSSGCQSIIYIPQDVVRAKEIIAQINT
LKTQVSYYAERLSRAAKDRSATGLERTLAILADKTRQLVTVCDCKLLANSIHGLNAARPDYIASKASPTS
TEEEQVMLRNDQDTLMARWTGRNSRSSLQVDWHEEEWEKVWLNVDKSLECIIQRVDKLLQKERLHGEGCE
DVFPCAGSCTSKKDCSPPPEESSPGEWSEALYPLLTTLTDCVAMMSDKAKKAMVFLLMQDSAPTIATYLS
LQYRRDVVFCQTLTALICGFIIKLRNCLHDDGFLRQLYTIGLLAQFESLLSTYGEELAMLEDMSLGIMDL
RNVTFKVTQATSSASADMLPVITGNRDGFNVRVPLPGPLFDALPREIQSGMLLRVQPVLFNVGINEQQTL
AERFGDTSLQEVINVESLVRLNSYFEQFKEVLPEDCLPRSRSQTCLPELLRFLGQNVHARKNKNVDILWQ
AAEICRRLNGVRFTSCKSAKDRTAMSVTLEQCLILQHEHGMAPQVFTQALECMRSEGCRRENTMKNVGSR
KYAFNSLQLKAFPKHYRPPEGTYGKVET

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004018
RefSeq Size 3217
RefSeq ORF 2814
Synonyms INPP4; TVAS1
Locus ID 3631
UniProt ID Q96PE3
Cytogenetics 2q11.2
Summary This gene encodes an Mg++ independent enzyme that hydrolyzes the 4-position phosphate from the inositol ring of phosphatidylinositol 3,4-bisphosphate, inositol 1,3,4-trisphosphate, and inositol 3,4-bisphosphate. Multiple transcript variants encoding distinct isoforms have been described. provided by RefSeq, Aug 2008
Protein Families Transmembrane
Protein Pathways Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "INPP4A" proteins (11)
SKU Description Size Price
PH318886 INPP4A MS Standard C13 and N15-labeled recombinant protein (NP_001557) 10 ug
$3,360.00
PH326284 INPP4A MS Standard C13 and N15-labeled recombinant protein (NP_001127696) 10 ug
$3,360.00
LC418285 Lyophilized INPP4A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419858 Lyophilized INPP4A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427381 Lyophilized INPP4A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418285 Transient overexpression lysate of inositol polyphosphate-4-phosphatase, type I, 107kDa (INPP4A), transcript variant a (as WB positive control) 100 ug
$665.00
LY419858 Transient overexpression lysate of inositol polyphosphate-4-phosphatase, type I, 107kDa (INPP4A), transcript variant b (as WB positive control) 100 ug
$665.00
LY427381 Transient overexpression lysate of inositol polyphosphate-4-phosphatase, type I, 107kDa (INPP4A), transcript variant d (as WB positive control) 100 ug
$665.00
TP311900 Recombinant protein of human inositol polyphosphate-4-phosphatase, type I, 107kDa (INPP4A), transcript variant a, 20 µg 20 ug
$867.00
TP318886 Recombinant protein of human inositol polyphosphate-4-phosphatase, type I, 107kDa (INPP4A), transcript variant b, 20 µg 20 ug
$867.00
TP326284 Recombinant protein of human inositol polyphosphate-4-phosphatase, type I, 107kDa (INPP4A), transcript variant d, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products