INPP4A (NM_001134224) Human Mass Spec Standard

SKU
PH326284
INPP4A MS Standard C13 and N15-labeled recombinant protein (NP_001127696)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC226284]
Predicted MW 109.8 kDa
Protein Sequence
Protein Sequence
>RC226284 representing NM_001134224
Red=Cloning site Green=Tags(s)

MTAREHSPRHGARARAMQRASTIDVAADMLGLSLAGNIQDPDEPILEFSLACSELHTPSLDRKPNSFVAV
SVTTPPQAFWTKHAQTEIIEGTNNPIFLSSIAFFQDSLINQMTQVKLSVYDVKDRSQGTMYLLGSGTFIV
KDLLQDRHHRLHLTLRSAESDRVGNITVIGWQMEEKSDQRPPVTRSVDTVNGRMVLPVDESLTEALGIRS
KYASLRKDTLLKSVFGGAICRMYRFPTTDGNHLRILEQMAESVLSLHVPRQFVKLLLEEDAARVCELEEL
GELSPCWESLRRQIVTQYQTIILTYQENLTDLHQYRGPSFKASSLKADKKLEFVPTNLHIQRMRVQDDGG
SDQNYDIVTIGAPAAHCQGFKSGGLRKKLHKFEETKKHFEECCTSSGCQSIIYIPQDVVRAKEIIAQINT
LKTQVSYYAERLSRAAKDRSATGLERTLAILADKTRQLVTVCDCKLLANSIHGLNAARPDYIASKASPTS
TEEEQVMLRNDQDTLMARWTGRNSRSSLQVDWHEEEWEKVWLNVDKSLECIIQRVDKLLQKERLHGEGCE
DVFPCAGSCTSKKGNPDSHAYWIRPEDPFCDVPSSPCPSTMPSTACHPHLTTHCSPPPEESSPGEWSEAL
YPLLTTLTDCVAMMSDKAKKAMVFLLMQDSAPTIATYLSLQYRRDVVFCQTLTALICGFIIKLRNCLHDD
GFLRQLYTIGLLAQFESLLSTYGEELAMLEDMSLGIMDLRNVTFKVTQATSSASADMLPVITGNRDGFNV
RVPLPGPLFDALPREIQSGMLLRVQPVLFNVGINEQQTLAERFGDTSLQEVINVESLVRLNSYFEQFKEV
LPEDCLPRSRSQTCLPELLRFLGQNVHARKNKNVDILWQAAEICRRLNGVRFTSCKSAKDRTAMSVTLEQ
CLILQHEHGMAPQVFTQALECMRSEGCRRENTMKNVGSRKYAFNSLQLKAFPKHYRPPEGTYGKVET

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001127696
RefSeq ORF 2931
Synonyms INPP4; TVAS1
Locus ID 3631
UniProt ID Q96PE3
Cytogenetics 2q11.2
Summary This gene encodes an Mg++ independent enzyme that hydrolyzes the 4-position phosphate from the inositol ring of phosphatidylinositol 3,4-bisphosphate, inositol 1,3,4-trisphosphate, and inositol 3,4-bisphosphate. Multiple transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Aug 2008]
Protein Families Transmembrane
Protein Pathways Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system
Write Your Own Review
You're reviewing:INPP4A (NM_001134224) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH311900 INPP4A MS Standard C13 and N15-labeled recombinant protein (NP_004018) 10 ug
$3,255.00
PH318886 INPP4A MS Standard C13 and N15-labeled recombinant protein (NP_001557) 10 ug
$3,255.00
LC418285 INPP4A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419858 INPP4A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427381 INPP4A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418285 Transient overexpression lysate of inositol polyphosphate-4-phosphatase, type I, 107kDa (INPP4A), transcript variant a 100 ug
$665.00
LY419858 Transient overexpression lysate of inositol polyphosphate-4-phosphatase, type I, 107kDa (INPP4A), transcript variant b 100 ug
$665.00
LY427381 Transient overexpression lysate of inositol polyphosphate-4-phosphatase, type I, 107kDa (INPP4A), transcript variant d 100 ug
$665.00
TP311900 Recombinant protein of human inositol polyphosphate-4-phosphatase, type I, 107kDa (INPP4A), transcript variant a, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP318886 Recombinant protein of human inositol polyphosphate-4-phosphatase, type I, 107kDa (INPP4A), transcript variant b, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP326284 Recombinant protein of human inositol polyphosphate-4-phosphatase, type I, 107kDa (INPP4A), transcript variant d, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.