INPP4A (NM_001134224) Human Recombinant Protein

SKU
TP326284
Recombinant protein of human inositol polyphosphate-4-phosphatase, type I, 107kDa (INPP4A), transcript variant d, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC226284 representing NM_001134224
Red=Cloning site Green=Tags(s)

MTAREHSPRHGARARAMQRASTIDVAADMLGLSLAGNIQDPDEPILEFSLACSELHTPSLDRKPNSFVAV
SVTTPPQAFWTKHAQTEIIEGTNNPIFLSSIAFFQDSLINQMTQVKLSVYDVKDRSQGTMYLLGSGTFIV
KDLLQDRHHRLHLTLRSAESDRVGNITVIGWQMEEKSDQRPPVTRSVDTVNGRMVLPVDESLTEALGIRS
KYASLRKDTLLKSVFGGAICRMYRFPTTDGNHLRILEQMAESVLSLHVPRQFVKLLLEEDAARVCELEEL
GELSPCWESLRRQIVTQYQTIILTYQENLTDLHQYRGPSFKASSLKADKKLEFVPTNLHIQRMRVQDDGG
SDQNYDIVTIGAPAAHCQGFKSGGLRKKLHKFEETKKHFEECCTSSGCQSIIYIPQDVVRAKEIIAQINT
LKTQVSYYAERLSRAAKDRSATGLERTLAILADKTRQLVTVCDCKLLANSIHGLNAARPDYIASKASPTS
TEEEQVMLRNDQDTLMARWTGRNSRSSLQVDWHEEEWEKVWLNVDKSLECIIQRVDKLLQKERLHGEGCE
DVFPCAGSCTSKKGNPDSHAYWIRPEDPFCDVPSSPCPSTMPSTACHPHLTTHCSPPPEESSPGEWSEAL
YPLLTTLTDCVAMMSDKAKKAMVFLLMQDSAPTIATYLSLQYRRDVVFCQTLTALICGFIIKLRNCLHDD
GFLRQLYTIGLLAQFESLLSTYGEELAMLEDMSLGIMDLRNVTFKVTQATSSASADMLPVITGNRDGFNV
RVPLPGPLFDALPREIQSGMLLRVQPVLFNVGINEQQTLAERFGDTSLQEVINVESLVRLNSYFEQFKEV
LPEDCLPRSRSQTCLPELLRFLGQNVHARKNKNVDILWQAAEICRRLNGVRFTSCKSAKDRTAMSVTLEQ
CLILQHEHGMAPQVFTQALECMRSEGCRRENTMKNVGSRKYAFNSLQLKAFPKHYRPPEGTYGKVET

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 109.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001127696
Locus ID 3631
UniProt ID Q96PE3
Cytogenetics 2q11.2
RefSeq ORF 2931
Synonyms INPP4; TVAS1
Summary This gene encodes an Mg++ independent enzyme that hydrolyzes the 4-position phosphate from the inositol ring of phosphatidylinositol 3,4-bisphosphate, inositol 1,3,4-trisphosphate, and inositol 3,4-bisphosphate. Multiple transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Aug 2008]
Protein Families Transmembrane
Protein Pathways Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system
Write Your Own Review
You're reviewing:INPP4A (NM_001134224) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH311900 INPP4A MS Standard C13 and N15-labeled recombinant protein (NP_004018) 10 ug
$3,255.00
PH318886 INPP4A MS Standard C13 and N15-labeled recombinant protein (NP_001557) 10 ug
$3,255.00
PH326284 INPP4A MS Standard C13 and N15-labeled recombinant protein (NP_001127696) 10 ug
$3,255.00
LC418285 INPP4A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419858 INPP4A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427381 INPP4A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418285 Transient overexpression lysate of inositol polyphosphate-4-phosphatase, type I, 107kDa (INPP4A), transcript variant a 100 ug
$665.00
LY419858 Transient overexpression lysate of inositol polyphosphate-4-phosphatase, type I, 107kDa (INPP4A), transcript variant b 100 ug
$665.00
LY427381 Transient overexpression lysate of inositol polyphosphate-4-phosphatase, type I, 107kDa (INPP4A), transcript variant d 100 ug
$665.00
TP311900 Recombinant protein of human inositol polyphosphate-4-phosphatase, type I, 107kDa (INPP4A), transcript variant a, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP318886 Recombinant protein of human inositol polyphosphate-4-phosphatase, type I, 107kDa (INPP4A), transcript variant b, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.