OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RAB5C (NM_201434) Human Mass Spec Standard

Be the first to review this product
SKU
PH310698
RAB5C MS Standard C13 and N15-labeled recombinant protein (NP_958842)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY404416 Transient overexpression lysate of RAB5C, member RAS oncogene family (RAB5C), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "RAB5C or NM_201434"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210698
Predicted MW 23.3 kDa
Protein Sequence
Protein Sequence
>RC210698 representing NM_201434
Red=Cloning site Green=Tags(s)

MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTV
KFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLAS
KRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASR
SQCCSN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_958842
RefSeq Size 1791
RefSeq ORF 648
Synonyms L1880; RAB5CL; RAB5L; RABL
Locus ID 5878
UniProt ID P51148
Cytogenetics 17q21.2
Summary Members of the Rab protein family are small GTPases of the Ras superfamily that are thought to ensure fidelity in the process of docking and/or fusion of vesicles with their correct acceptor compartment (Han et al., 1996 PubMed 8646882).supplied by OMIM, Nov 2010
Protein Families Druggable Genome
Protein Pathways Endocytosis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RAB5C" proteins (3)
SKU Description Size Price
LC404416 Lyophilized RAB5C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404416 Transient overexpression lysate of RAB5C, member RAS oncogene family (RAB5C), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP310698 Purified recombinant protein of Homo sapiens RAB5C, member RAS oncogene family (RAB5C), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products