RAB5C (NM_201434) Human Recombinant Protein
SKU
TP310698
Purified recombinant protein of Homo sapiens RAB5C, member RAS oncogene family (RAB5C), transcript variant 1, 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC210698 representing NM_201434
Red=Cloning site Green=Tags(s) MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTV KFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLAS KRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASR SQCCSN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Bioactivity | Enzyme activity (PMID: 26030178) |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_958842 |
Locus ID | 5878 |
UniProt ID | P51148 |
Cytogenetics | 17q21.2 |
RefSeq Size | 1791 |
RefSeq ORF | 648 |
Synonyms | L1880; RAB5CL; RAB5L; RABL |
Summary | Members of the Rab protein family are small GTPases of the Ras superfamily that are thought to ensure fidelity in the process of docking and/or fusion of vesicles with their correct acceptor compartment (Han et al., 1996 [PubMed 8646882]).[supplied by OMIM, Nov 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Endocytosis |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH310698 | RAB5C MS Standard C13 and N15-labeled recombinant protein (NP_958842) | 10 ug |
$3,255.00
|
|
LC404416 | RAB5C HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY404416 | Transient overexpression lysate of RAB5C, member RAS oncogene family (RAB5C), transcript variant 1 | 100 ug |
$436.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.