OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RAB5C (NM_201434) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP310698
Purified recombinant protein of Homo sapiens RAB5C, member RAS oncogene family (RAB5C), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "RAB5C or NM_201434"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC210698 representing NM_201434
Red=Cloning site Green=Tags(s)

MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTV
KFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLAS
KRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASR
SQCCSN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 23.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity Enzyme activity (PMID: 26030178)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_958842
Locus ID 5878
UniProt ID P51148
Cytogenetics 17q21.2
RefSeq Size 1791
RefSeq ORF 648
Synonyms L1880; RAB5CL; RAB5L; RABL
Summary Members of the Rab protein family are small GTPases of the Ras superfamily that are thought to ensure fidelity in the process of docking and/or fusion of vesicles with their correct acceptor compartment (Han et al., 1996 PubMed 8646882).supplied by OMIM, Nov 2010
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Protein Pathways Endocytosis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RAB5C" proteins (3)
SKU Description Size Price
PH310698 RAB5C MS Standard C13 and N15-labeled recombinant protein (NP_958842) 10 ug
$3,360.00
LC404416 Lyophilized RAB5C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404416 Transient overexpression lysate of RAB5C, member RAS oncogene family (RAB5C), transcript variant 1 (as WB positive control) 100 ug
$436.00

file-alt Citations

Epigenetic activation of a cryptic TBC1D16 transcript enhances melanoma progression by targeting EGFR
Vizoso, Ferreira, Lopez-Serra et al
Nat. Med. (2015)
Cited by 120
AI Summary: In this study, OriGene’s recombinant RAB5C GTPase (catalog number TP310698) was used to investigate the interaction between TBC1D16-47KD and RAB5C, helping to elucidate the molecular mechanisms underlying melanoma progression.
Snippet: FLAG-TBC1D16-47KD protein was purified from HEK293T cells. Recombinant RAB5C GTPase (100 pmol) (Origene, TP310698) was loaded with [γ−32P]GTP for 10 min at 25 °C and desalted on PD-SpinTrapTM G-25 columns (GE Healthcare, # 28-9180-04) to remove free nucleotide
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products