OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TRAPPC2L (NM_016209) Human Mass Spec Standard

Be the first to review this product
SKU
PH310647
TRAPPC2L MS Standard C13 and N15-labeled recombinant protein (NP_057293)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA345055 Rabbit Polyclonal Anti-TRAPPC2L Antibody - N-terminal region
100 ul
$585.00
LY414123 Transient overexpression lysate of trafficking protein particle complex 2-like (TRAPPC2L) (as WB positive control) 100 ug
$436.00

Other products for "TRAPPC2L or NM_016209"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210647
Predicted MW 16.1 kDa
Protein Sequence
Protein Sequence
>RC210647 protein sequence
Red=Cloning site Green=Tags(s)

MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKALVDQRELYLGLLYPTEDYKVY
GYVTNSKVKFVMVVDSSNTALRDNEIRSMFRKLHNSYTDVMCNPFYNPGDRIQSSRAFDNMVTSMMIQVC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057293
RefSeq Size 637
RefSeq ORF 420
Synonyms HSPC176; PERRB
Locus ID 51693
UniProt ID Q9UL33
Cytogenetics 16q24.3
Summary This gene encodes a protein that interacts with the tethering factor trafficking protein particle (TRAPP complex). TRAPP complexes mediate the contact between vescicles and target membranes, and thus, are involved in vescicle-mediated transport of proteins and lipids. The encoded protein is related to the X-linked trafficking protein particle complex 2. A related pseudogene is located on the X chromosome. Alternative splicing results in multiple transcript variants encoding different isoforms. provided by RefSeq, Jan 2016
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TRAPPC2L" proteins (3)
SKU Description Size Price
LC414123 Lyophilized TRAPPC2L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414123 Transient overexpression lysate of trafficking protein particle complex 2-like (TRAPPC2L) (as WB positive control) 100 ug
$436.00
TP310647 Recombinant protein of human trafficking protein particle complex 2-like (TRAPPC2L), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products