TRAPPC2L Rabbit Polyclonal Antibody

SKU TA345055

Rabbit Polyclonal Anti-TRAPPC2L Antibody - N-terminal region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRAPPC2L antibody: synthetic peptide directed towards the N terminal of human TRAPPC2L. Synthetic peptide located within the following region: MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKAL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 16 kDa
• Gene Name: trafficking protein particle complex 2-like
• Database Link:
  NP_057293
  Q9UL33
• Background: TRAPPC2L may play a role in vesicular transport from endoplasmic reticulum to Golgi.
• Synonyms: HSPC176
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Zebrafish: 86%

Reference Data