TRAPPC2L (NM_016209) Human Tagged ORF Clone

SKU
RC210647
TRAPPC2L (Myc-DDK-tagged)-Human trafficking protein particle complex 2-like (TRAPPC2L)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TRAPPC2L
Synonyms HSPC176; PERRB
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210647 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGTGTGCATCGCGGTGATTGCCAAGGAGAATTACCCCCTCTACATTCGCAGCACCCCTACGGAGA
ACGAGCTGAAGTTCCACTACATGGTGCACACATCTCTGGACGTGGTGGATGAGAAGATCTCCGCAATGGG
GAAGGCCCTGGTCGACCAGAGGGAGCTGTACCTGGGCCTGCTCTACCCCACGGAGGACTACAAGGTATAC
GGCTACGTCACCAACTCCAAGGTGAAGTTTGTCATGGTGGTAGATTCCTCCAACACAGCCCTTCGAGACA
ACGAAATTCGCAGCATGTTCCGGAAGCTACACAACTCCTACACAGACGTGATGTGCAACCCCTTCTACAA
CCCGGGGGACCGCATCCAGTCCAGCAGGGCCTTTGATAACATGGTGACGTCGATGATGATACAGGTGTGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210647 protein sequence
Red=Cloning site Green=Tags(s)

MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKALVDQRELYLGLLYPTEDYKVY
GYVTNSKVKFVMVVDSSNTALRDNEIRSMFRKLHNSYTDVMCNPFYNPGDRIQSSRAFDNMVTSMMIQVC

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_016209
ORF Size 420 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016209.5
RefSeq Size 637 bp
RefSeq ORF 423 bp
Locus ID 51693
UniProt ID Q9UL33
Cytogenetics 16q24.3
MW 16.1 kDa
Summary This gene encodes a protein that interacts with the tethering factor trafficking protein particle (TRAPP complex). TRAPP complexes mediate the contact between vescicles and target membranes, and thus, are involved in vescicle-mediated transport of proteins and lipids. The encoded protein is related to the X-linked trafficking protein particle complex 2. A related pseudogene is located on the X chromosome. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2016]
Write Your Own Review
You're reviewing:TRAPPC2L (NM_016209) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210647L3 Lenti ORF clone of Human trafficking protein particle complex 2-like (TRAPPC2L), Myc-DDK-tagged 10 ug
$450.00
RC210647L4 Lenti ORF clone of Human trafficking protein particle complex 2-like (TRAPPC2L), mGFP tagged 10 ug
$450.00
RG210647 TRAPPC2L (tGFP-tagged) - Human trafficking protein particle complex 2-like (TRAPPC2L) 10 ug
$489.00
SC127499 TRAPPC2L (untagged)-Human trafficking protein particle complex 2-like (TRAPPC2L) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.