OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CCN4 (NM_003882) Human Mass Spec Standard

Be the first to review this product
SKU
PH310402
WISP1 MS Standard C13 and N15-labeled recombinant protein (NP_003873)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY403320 Transient overexpression lysate of WNT1 inducible signaling pathway protein 1 (WISP1), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "CCN4 or NM_003882"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210402
Predicted MW 40.3 kDa
Protein Sequence
Protein Sequence
>RC210402 protein sequence
Red=Cloning site Green=Tags(s)

MRWFLPWTLAAVTAAAASTVLATALSPAPTTMDFTPAPLEDTSSRPQFCKWPCECPPSPPRCPLGVSLIT
DGCECCKMCAQQLGDNCTEAAICDPHRGLYCDYSGDRPRYAIGVCAQVVGVGCVLDGVRYNNGQSFQPNC
KYNCTCIDGAVGCTPLCLRVRPPRLWCPHPRRVSIPGHCCEQWVCEDDAKRPRKTAPRDTGAFDAVGEVE
AWHRNCIAYTSPWSPCSTSCGLGVSTRISNVNAQCWPEQESRLCNLRPCDVDIHTLIKAGKKCLAVYQPE
ASMNFTLAGCISTRSYQPKYCGVCMDNRCCIPYKSKTIDVSFQCPDGLGFSRQVLWINACFCNLSCRNPN
DIFADLESYPDFSEIAN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003873
RefSeq Size 5194
RefSeq ORF 1101
Synonyms WISP1; WISP1-OT1; WISP1-UT1; WISP1c; WISP1i; WISP1tc
Locus ID 8840
UniProt ID O95388
Cytogenetics 8q24.22
Summary This gene encodes a member of the WNT1 inducible signaling pathway (WISP) protein subfamily, which belongs to the connective tissue growth factor (CTGF) family. WNT1 is a member of a family of cysteine-rich, glycosylated signaling proteins that mediate diverse developmental processes. The CTGF family members are characterized by four conserved cysteine-rich domains: insulin-like growth factor-binding domain, von Willebrand factor type C module, thrombospondin domain and C-terminal cystine knot-like domain. This gene may be downstream in the WNT1 signaling pathway that is relevant to malignant transformation. It is expressed at a high level in fibroblast cells, and overexpressed in colon tumors. The encoded protein binds to decorin and biglycan, two members of a family of small leucine-rich proteoglycans present in the extracellular matrix of connective tissue, and possibly prevents the inhibitory activity of decorin and biglycan in tumor cell proliferation. It also attenuates p53-mediated apoptosis in response to DNA damage through activation of the Akt kinase. It is 83% identical to the mouse protein at the amino acid level. Multiple alternatively spliced transcript variants have been identified. provided by RefSeq, Mar 2011
Protein Families Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Secreted Protein, Stem cell relevant signaling - DSL/Notch pathway, Stem cell relevant signaling - Wnt Signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CCN4" proteins (6)
SKU Description Size Price
LC403320 Lyophilized WISP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418374 Lyophilized WISP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403320 Transient overexpression lysate of WNT1 inducible signaling pathway protein 1 (WISP1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY418374 Transient overexpression lysate of WNT1 inducible signaling pathway protein 1 (WISP1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP310402 Recombinant protein of human WNT1 inducible signaling pathway protein 1 (WISP1), transcript variant 1, 20 µg 20 ug
$867.00
TP761856 Purified recombinant protein of Human WNT1 inducible signaling pathway protein 1 (WISP1), transcript variant 2, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products