OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CCN4 (NM_003882) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC210402
WISP1 (Myc-DDK-tagged)-Human WNT1 inducible signaling pathway protein 1 (WISP1), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
  $686.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA367372 CCN4 rabbit polyclonal antibody
100 ul
$310.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "CCN4 or NM_003882"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CCN4
Synonyms WISP1; WISP1-OT1; WISP1-UT1; WISP1c; WISP1i; WISP1tc
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210402 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGTGGTTCCTGCCCTGGACGCTGGCAGCAGTGACAGCAGCAGCCGCCAGCACCGTCCTGGCCACGG
CCCTCTCTCCAGCCCCTACGACCATGGACTTTACCCCAGCTCCACTGGAGGACACCTCCTCACGCCCCCA
ATTCTGCAAGTGGCCATGTGAGTGCCCGCCATCCCCACCCCGCTGCCCGCTGGGGGTCAGCCTCATCACA
GATGGCTGTGAGTGCTGTAAGATGTGCGCTCAGCAGCTTGGGGACAACTGCACGGAGGCTGCCATCTGTG
ACCCCCACCGGGGCCTCTACTGTGACTACAGCGGGGACCGCCCGAGGTACGCAATAGGAGTGTGTGCACA
GGTGGTCGGTGTGGGCTGCGTCCTGGATGGGGTGCGCTACAACAACGGCCAGTCCTTCCAGCCTAACTGC
AAGTACAACTGCACGTGCATCGACGGCGCGGTGGGCTGCACACCACTGTGCCTCCGAGTGCGCCCCCCGC
GTCTCTGGTGCCCCCACCCGCGGCGCGTGAGCATACCTGGCCACTGCTGTGAGCAGTGGGTATGTGAGGA
CGACGCCAAGAGGCCACGCAAGACCGCACCCCGTGACACAGGAGCCTTCGATGCTGTGGGTGAGGTGGAG
GCATGGCACAGGAACTGCATAGCCTACACAAGCCCCTGGAGCCCTTGCTCCACCAGCTGCGGCCTGGGGG
TCTCCACTCGGATCTCCAATGTTAACGCCCAGTGCTGGCCTGAGCAAGAGAGCCGCCTCTGCAACTTGCG
GCCATGCGATGTGGACATCCATACACTCATTAAGGCAGGGAAGAAGTGTCTGGCTGTGTACCAGCCAGAG
GCATCCATGAACTTCACACTTGCGGGCTGCATCAGCACACGCTCCTATCAACCCAAGTACTGTGGAGTTT
GCATGGACAATAGGTGCTGCATCCCCTACAAGTCTAAGACTATCGACGTGTCCTTCCAGTGTCCTGATGG
GCTTGGCTTCTCCCGCCAGGTCCTATGGATTAATGCCTGCTTCTGTAACCTGAGCTGTAGGAATCCCAAT
GACATCTTTGCTGACTTGGAATCCTACCCTGACTTCTCAGAAATTGCCAAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC210402 protein sequence
Red=Cloning site Green=Tags(s)

MRWFLPWTLAAVTAAAASTVLATALSPAPTTMDFTPAPLEDTSSRPQFCKWPCECPPSPPRCPLGVSLIT
DGCECCKMCAQQLGDNCTEAAICDPHRGLYCDYSGDRPRYAIGVCAQVVGVGCVLDGVRYNNGQSFQPNC
KYNCTCIDGAVGCTPLCLRVRPPRLWCPHPRRVSIPGHCCEQWVCEDDAKRPRKTAPRDTGAFDAVGEVE
AWHRNCIAYTSPWSPCSTSCGLGVSTRISNVNAQCWPEQESRLCNLRPCDVDIHTLIKAGKKCLAVYQPE
ASMNFTLAGCISTRSYQPKYCGVCMDNRCCIPYKSKTIDVSFQCPDGLGFSRQVLWINACFCNLSCRNPN
DIFADLESYPDFSEIAN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_003882
ORF Size 1101 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003882.4
RefSeq Size 5194 bp
RefSeq ORF 1104 bp
Locus ID 8840
UniProt ID O95388
Cytogenetics 8q24.22
Domains CT, Cys_knot, IB, tsp_1, VWC
Protein Families Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Secreted Protein, Stem cell relevant signaling - DSL/Notch pathway, Stem cell relevant signaling - Wnt Signaling pathway
MW 40.3 kDa
Summary This gene encodes a member of the WNT1 inducible signaling pathway (WISP) protein subfamily, which belongs to the connective tissue growth factor (CTGF) family. WNT1 is a member of a family of cysteine-rich, glycosylated signaling proteins that mediate diverse developmental processes. The CTGF family members are characterized by four conserved cysteine-rich domains: insulin-like growth factor-binding domain, von Willebrand factor type C module, thrombospondin domain and C-terminal cystine knot-like domain. This gene may be downstream in the WNT1 signaling pathway that is relevant to malignant transformation. It is expressed at a high level in fibroblast cells, and overexpressed in colon tumors. The encoded protein binds to decorin and biglycan, two members of a family of small leucine-rich proteoglycans present in the extracellular matrix of connective tissue, and possibly prevents the inhibitory activity of decorin and biglycan in tumor cell proliferation. It also attenuates p53-mediated apoptosis in response to DNA damage through activation of the Akt kinase. It is 83% identical to the mouse protein at the amino acid level. Multiple alternatively spliced transcript variants have been identified. provided by RefSeq, Mar 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_003882" in other vectors (6)
SKU Description Size Price
RC210402L1 Lenti ORF clone of Human WNT1 inducible signaling pathway protein 1 (WISP1), transcript variant 1, Myc-DDK-tagged 10 ug
$986.00
RC210402L2 Lenti ORF clone of Human WNT1 inducible signaling pathway protein 1 (WISP1), transcript variant 1, mGFP tagged 10 ug
$986.00
RC210402L3 Lenti ORF clone of Human WNT1 inducible signaling pathway protein 1 (WISP1), transcript variant 1, Myc-DDK-tagged 10 ug
$986.00
RC210402L4 Lenti ORF clone of Human WNT1 inducible signaling pathway protein 1 (WISP1), transcript variant 1, mGFP tagged 10 ug
$986.00
RG210402 WISP1 (tGFP-tagged) - Human WNT1 inducible signaling pathway protein 1 (WISP1), transcript variant 1 10 ug
$886.00
SC303397 WISP1 (untagged)-Human WNT1 inducible signaling pathway protein 1 (WISP1), transcript variant 1 10 ug
$686.00

Plasmid Map for RC210402

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC210402
Circular map for RC210402

file-alt Citations

WNT1-inducible signaling protein-1 mediates TGF-β1-induced renal fibrosis in tubular epithelial cells and unilateral ureteral obstruction mouse models via autophagy
Yang, Wang, Tu et al
J. Cell. Physiol. (2019) 235 (3), 2009-2022 DOI: 10.1002/jcp.29187
AI Summary: In this study, OriGene's WISP-1 Trilencer-27 rat siRNA (SR509133) was used to specifically knock down WISP-1 expression in tubular epithelial cells, enabling the researchers to investigate the role of WISP-1 in TGF-β1-induced renal fibrosis and autophagy.
Snippet: … To downregulate WISP‐1 in TECs, WISP‐1 Trilencer‐27 rat siRNA (SR509133, OriGene) or a negative control siRNA was transfected into cells in six‐well plates for 24 hr by Lipofectamine 2000 (11668027;Invitrogen, CA);- CA). To downregulate WISP‐1 in TECs, WISP‐1 Trilencer‐27 rat siRNA (SR509133, OriGene) or a negative control siRNA was transfected into cells in six‐well plates for 24 hr by Lipofectamine 2000 (11668027
Thymosin β4 Prevents Angiotensin II-Induced Cardiomyocyte Growth by Regulating Wnt/WISP Signaling
Li, Guleria, Thakur et al
J. Cell. Physiol. (2015)
Cited by 14
AI Summary: OriGene contributed to this study by providing the WISP-1 plasmid, which was used to overexpress WISP-1 in cardiomyocytes and assess its role in angiotensin II-induced cell growth and the protective effects of Thymosin β4.
Snippet: Collagenase type II was purchased from Worthington Biochemical Corporation (Lakewood, NJ, USA). WISP- 1 plasmid was from Origene Technologies Inc. (Rockville, MD, USA). Dulbecco's Modified Eagle Medium (DMEM), Opti-MEM Reduced Serum Medium, non ... Cite SaveSaving
WNT1-Inducible Signaling Protein-1 Mediates Renal Fibrosis Via Autophagy Both in Vivo and in Vitro
Yang, Tu, Li et al
Available at SSRN  (2018)
Snippet: To downregulate WISP-1 in TECs, WISP-1 Trilencer-27 rat siRNA (SR509133, OriGene, USA) or an negative control siRNA (RC210402, OriGene, USA) and control vector were stimulated with TGF-β1 (2 ng/ml) for 0 or 24 hours after starvation in serum-free medium
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products