OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Amyloid Precursor Protein (APP) (NM_201413) Human Mass Spec Standard

Be the first to review this product
SKU
PH309575
APP MS Standard C13 and N15-labeled recombinant protein (NP_958816)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA500969 Anti-APP (Amyloid beta precursor protein) mouse monoclonal antibody, clone OTI7G9 (formerly 7G9) 100 ul
$447.00
LY404408 Transient overexpression lysate of amyloid beta (A4) precursor protein (APP), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "Amyloid Precursor Protein or NM_201413"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209575
Predicted MW 83 kDa
Protein Sequence
Protein Sequence
>RC209575 representing NM_201413
Red=Cloning site Green=Tags(s)

MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGIL
QYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQER
MDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWW
GGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTT
ESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAIPTTAA
STPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKV
ESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTL
KHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLAN
MISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRG
LTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVIT
LVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_958816
RefSeq Size 3584
RefSeq ORF 2253
Synonyms AAA; ABETA; ABPP; AD1; alpha-sAPP; APPI; CTFgamma; CVAP; PN-II; PN2; preA4
Locus ID 351
UniProt ID P05067
Cytogenetics 21q21.3
Summary This gene encodes a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. In addition, two of the peptides are antimicrobial peptides, having been shown to have bacteriocidal and antifungal activities. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene. provided by RefSeq, Aug 2014
Protein Families Druggable Genome, Transmembrane
Protein Pathways Alzheimer's disease
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Amyloid Precursor Protein" proteins (11)
SKU Description Size Price
PH315147 APP MS Standard C13 and N15-labeled recombinant protein (NP_958817) 10 ug
$3,360.00
LC404408 Lyophilized APP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404409 Lyophilized APP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424694 Lyophilized APP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427815 Lyophilized APP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404408 Transient overexpression lysate of amyloid beta (A4) precursor protein (APP), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY404409 Transient overexpression lysate of amyloid beta (A4) precursor protein (APP), transcript variant 3 (as WB positive control) 100 ug
$665.00
LY424694 Transient overexpression lysate of amyloid beta (A4) precursor protein (APP), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY427815 Transient overexpression lysate of amyloid beta (A4) precursor protein (APP), transcript variant 5 (as WB positive control) 100 ug
$436.00
TP309575 Recombinant protein of human amyloid beta (A4) precursor protein (APP), transcript variant 2, 20 µg 20 ug
$867.00
TP315147 Recombinant protein of human amyloid beta (A4) precursor protein (APP), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

Leptin boosts cellular metabolism by activating AMPK and the sirtuins to reduce tau phosphorylation and β-amyloid in neurons
Greco, Hamzelou, Johnston et al
Biochem. Biophys. Res. Commun. (2011) 414 (1), 170-4 DOI: 10.1016/j.bbrc.2011.09.050
Cited by 87
AI Summary: OriGene Technologies contributed to the study by providing the mammalian expression vector encoding the 751 amino acid isoform of human APP (APP751 – Accession # NM_201413), which was used to investigate the effects of leptin on tau phosphorylation and β-amyloid production in neurons.
Snippet: with a mammalian expression vector encoding the 751 amino acid isoform of human APP (APP 751 – Accession # NM_201413) (Origene Technologies;Rockville ... Mitochondrial dysfunction and tau hyperphosphorylation in Ts1Cje, a mouse model for Down syndrome. Hum. Mol.
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products