OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PRMT6 (NM_018137) Human Mass Spec Standard

Be the first to review this product
SKU
PH309527
PRMT6 MS Standard C13 and N15-labeled recombinant protein (NP_060607)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY413290 Transient overexpression lysate of protein arginine methyltransferase 6 (PRMT6) (as WB positive control) 100 ug
$436.00

Other products for "PRMT6 or NM_018137"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209527
Predicted MW 35.2 kDa
Protein Sequence
Protein Sequence
>RC209527 protein sequence
Red=Cloning site Green=Tags(s)

MIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRVYAVEASAIWQQAREVVRFNGL
EDRVHVLPGPVETVELPEQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFIAPISDQ
MLEWRLGFWSQVKQHYGVDMSCLEGFATRCLMGHSEIVVQGLSGEDVLARPQRFAQLELSRAGLEQELEA
GVGGRFRCSCYGSAPMHGFAIWFQVTFPGGESEKPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSG
EITLLPSRDNPRRLRVLLRYKVGDQEEKTKDFAMED

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060607
RefSeq Size 2665
RefSeq ORF 948
Synonyms HRMT1L6
Locus ID 55170
UniProt ID Q96LA8
Cytogenetics 1p13.3
Summary The protein encoded by this gene belongs to the arginine N-methyltransferase family, which catalyze the sequential transfer of methyl group from S-adenosyl-L-methionine to the side chain nitrogens of arginine residues within proteins, to form methylated arginine derivatives and S-adenosyl-L-homocysteine. This protein can catalyze both, the formation of omega-N monomethylarginine and asymmetrical dimethylarginine, with a strong preference for the latter. It specifically mediates the asymmetric dimethylation of Arg2 of histone H3, and the methylated form represents a specific tag for epigenetic transcriptional repression. This protein also forms a complex with, and methylates DNA polymerase beta, resulting in stimulation of polymerase activity by enhancing DNA binding and processivity. provided by RefSeq, Sep 2011
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PRMT6" proteins (6)
SKU Description Size Price
LC413290 Lyophilized PRMT6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432201 Lyophilized PRMT6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413290 Transient overexpression lysate of protein arginine methyltransferase 6 (PRMT6) (as WB positive control) 100 ug
$436.00
LY432201 Transient overexpression lysate of protein arginine methyltransferase 6 (PRMT6) (as WB positive control) 100 ug
$436.00
TP309527 Recombinant protein of human protein arginine methyltransferase 6 (PRMT6), 20 µg 20 ug
$867.00
TP329177 Recombinant protein of human protein arginine methyltransferase 6 (PRMT6), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products