PRMT6 (NM_018137) Human Tagged ORF Clone

SKU
RC209527
PRMT6 (Myc-DDK-tagged)-Human protein arginine methyltransferase 6 (PRMT6)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PRMT6
Synonyms HRMT1L6
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC209527 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATCGCGGACCGCGTCCGCACCGATGCCTACCGCCTGGGTATCCTTCGGAACTGGGCAGCACTGCGAG
GCAAGACGGTACTGGACGTGGGCGCGGGCACCGGCATTCTGAGCATCTTCTGTGCCCAGGCCGGGGCCCG
GCGCGTGTACGCGGTAGAGGCCAGCGCCATCTGGCAACAGGCCCGGGAGGTGGTGCGGTTCAACGGGCTG
GAGGACCGGGTGCACGTCCTGCCGGGACCAGTGGAGACTGTAGAGTTGCCGGAACAGGTGGATGCCATCG
TGAGCGAGTGGATGGGCTACGGACTCCTGCACGAGTCCATGCTGAGCTCCGTCCTCCACGCGCGAACCAA
GTGGCTGAAGGAGGGCGGTCTTCTCCTGCCGGCCTCCGCCGAGCTCTTCATAGCCCCCATCAGCGACCAG
ATGCTGGAATGGCGCCTGGGCTTCTGGAGCCAGGTGAAGCAGCACTATGGTGTGGACATGAGCTGCCTGG
AGGGCTTCGCCACGCGCTGTCTCATGGGCCACTCGGAGATCGTTGTGCAGGGATTGTCCGGCGAGGACGT
GCTGGCCCGGCCGCAGCGCTTTGCTCAGCTAGAGCTCTCCCGCGCCGGCTTGGAGCAGGAGCTGGAGGCC
GGAGTGGGCGGGCGCTTCCGCTGCAGCTGCTATGGCTCGGCGCCCATGCATGGCTTTGCCATCTGGTTCC
AGGTGACCTTCCCTGGAGGGGAGTCGGAGAAACCCCTGGTGCTGTCCACCTCGCCTTTTCACCCGGCCAC
TCACTGGAAACAGGCGCTCCTCTACCTGAACGAGCCGGTGCAAGTGGAGCAAGACACGGACGTTTCAGGA
GAGATCACGCTGCTGCCCTCCCGGGACAACCCCCGTCGCCTGCGCGTGCTGCTGCGCTACAAAGTGGGAG
ACCAGGAGGAGAAGACCAAAGACTTTGCCATGGAGGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC209527 protein sequence
Red=Cloning site Green=Tags(s)

MIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRVYAVEASAIWQQAREVVRFNGL
EDRVHVLPGPVETVELPEQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFIAPISDQ
MLEWRLGFWSQVKQHYGVDMSCLEGFATRCLMGHSEIVVQGLSGEDVLARPQRFAQLELSRAGLEQELEA
GVGGRFRCSCYGSAPMHGFAIWFQVTFPGGESEKPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSG
EITLLPSRDNPRRLRVLLRYKVGDQEEKTKDFAMED

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_018137
ORF Size 948 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_018137.1, NP_060607.1
RefSeq Size 2665 bp
RefSeq ORF 1128 bp
Locus ID 55170
UniProt ID Q96LA8
Cytogenetics 1p13.3
Protein Families Druggable Genome
MW 35.2 kDa
Summary The protein encoded by this gene belongs to the arginine N-methyltransferase family, which catalyze the sequential transfer of methyl group from S-adenosyl-L-methionine to the side chain nitrogens of arginine residues within proteins, to form methylated arginine derivatives and S-adenosyl-L-homocysteine. This protein can catalyze both, the formation of omega-N monomethylarginine and asymmetrical dimethylarginine, with a strong preference for the latter. It specifically mediates the asymmetric dimethylation of Arg2 of histone H3, and the methylated form represents a specific tag for epigenetic transcriptional repression. This protein also forms a complex with, and methylates DNA polymerase beta, resulting in stimulation of polymerase activity by enhancing DNA binding and processivity. [provided by RefSeq, Sep 2011]
Write Your Own Review
You're reviewing:PRMT6 (NM_018137) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC209527L3 Lenti ORF clone of Human protein arginine methyltransferase 6 (PRMT6), Myc-DDK-tagged 10 ug
$600.00
RC209527L4 Lenti ORF clone of Human protein arginine methyltransferase 6 (PRMT6), mGFP tagged 10 ug
$600.00
RC229177 PRMT6 (Myc-DDK-tagged)-Human protein arginine methyltransferase 6 (PRMT6) 10 ug
$457.00
RC229177L1 Lenti ORF clone of Human protein arginine methyltransferase 6 (PRMT6), Myc-DDK-tagged 10 ug
$757.00
RC229177L2 Lenti ORF clone of Human protein arginine methyltransferase 6 (PRMT6), mGFP tagged 10 ug
$757.00
RC229177L3 Lenti ORF clone of Human protein arginine methyltransferase 6 (PRMT6), Myc-DDK-tagged 10 ug
$757.00
RC229177L4 Lenti ORF clone of Human protein arginine methyltransferase 6 (PRMT6), mGFP tagged 10 ug
$757.00
RG209527 PRMT6 (tGFP-tagged) - Human protein arginine methyltransferase 6 (PRMT6) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
RG229177 PRMT6 (tGFP-tagged) - Human protein arginine methyltransferase 6 (PRMT6) 10 ug
$657.00
SC111320 PRMT6 (untagged)-Human protein arginine methyltransferase 6 (PRMT6) 10 ug
$300.00
SC327812 PRMT6 (untagged)-Human protein arginine methyltransferase 6 (PRMT6) 10 ug
$503.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.