OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RAB22A (NM_020673) Human Mass Spec Standard

Be the first to review this product
SKU
PH309511
RAB22A MS Standard C13 and N15-labeled recombinant protein (NP_065724)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY402804 Transient overexpression lysate of RAB22A, member RAS oncogene family (RAB22A) (as WB positive control) 100 ug
$436.00

Other products for "RAB22A or NM_020673"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209511
Predicted MW 21.9 kDa
Protein Sequence
Protein Sequence
>RC209511 protein sequence
Red=Cloning site Green=Tags(s)

MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRAL
APMYYRGSAAAIIVYDITKEETFSTLKNWVKELRQHGPPNIVVAIAGNKCDLIDVREVMERDAKDYADSI
HAIFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRSCC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_065724
RefSeq Size 8702
RefSeq ORF 582
Locus ID 57403
UniProt ID Q9UL26
Cytogenetics 20q13.32
Summary The protein encoded by this gene is a member of the RAB family of small GTPases. The GTP-bound form of the encoded protein has been shown to interact with early-endosomal antigen 1, and may be involved in the trafficking of and interaction between endosomal compartments. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Protein Pathways Endocytosis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RAB22A" proteins (3)
SKU Description Size Price
LC402804 Lyophilized RAB22A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402804 Transient overexpression lysate of RAB22A, member RAS oncogene family (RAB22A) (as WB positive control) 100 ug
$436.00
TP309511 Recombinant protein of human RAB22A, member RAS oncogene family (RAB22A), 20 µg 20 ug
$867.00

file-alt Citations

Microtubule-dependent endosomal sorting of clathrin-independent cargo by Hook1
Maldonado-Báez, Cole, Krämer et al
J. Cell Biol. (2013) 201 (2), 233-47 DOI: 10.1083/jcb.201208172
Cited by 134
AI Summary: In this study, OriGene products—including the human CD98 (cat# SC119827) and CD147 (cat# SC119708) Myc-DDK-tagged cDNA clones—were used to express and analyze the trafficking of these CIE cargo proteins, enabling the investigation of Hook1's role in their endosomal sorting and recycling.
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products