RAB22A (NM_020673) Human Tagged ORF Clone

SKU
RC209511
RAB22A (Myc-DDK-tagged)-Human RAB22A, member RAS oncogene family (RAB22A)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RAB22A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC209511 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCTGAGGGAGCTCAAAGTGTGTCTGCTCGGGGATACAGGTGTAGGTAAATCGAGTATTGTGTGGC
GGTTTGTGGAAGACAGTTTTGATCCAAACATCAACCCAACAATAGGGGCATCTTTTATGACCAAGACTGT
CCAGTACCAAAATGAGCTACATAAATTCCTAATCTGGGATACAGCTGGACAAGAACGATTTCGTGCCTTA
GCACCAATGTACTATCGAGGGTCGGCTGCAGCTATAATCGTTTATGATATCACAAAAGAAGAGACATTTT
CAACATTAAAGAATTGGGTGAAAGAGCTTCGACAGCATGGCCCACCTAATATTGTAGTTGCCATTGCAGG
AAATAAATGTGATCTTATCGATGTAAGAGAAGTCATGGAGAGAGATGCAAAGGACTACGCCGACTCTATT
CATGCAATTTTTGTAGAGACCAGCGCAAAAAACGCGATAAACATAAATGAACTCTTTATAGAAATTAGTC
GAAGAATTCCATCCACTGACGCCAACCTGCCATCTGGCGGTAAGGGCTTCAAACTCCGAAGACAGCCTTC
AGAGCCAAAGCGGAGCTGCTGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC209511 protein sequence
Red=Cloning site Green=Tags(s)

MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRAL
APMYYRGSAAAIIVYDITKEETFSTLKNWVKELRQHGPPNIVVAIAGNKCDLIDVREVMERDAKDYADSI
HAIFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRSCC

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_020673
ORF Size 582 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_020673.3
RefSeq Size 8702 bp
RefSeq ORF 585 bp
Locus ID 57403
UniProt ID Q9UL26
Cytogenetics 20q13.32
Domains RAB, RAN, ras, RAS, RHO
Protein Families Druggable Genome
Protein Pathways Endocytosis
MW 21.9 kDa
Summary The protein encoded by this gene is a member of the RAB family of small GTPases. The GTP-bound form of the encoded protein has been shown to interact with early-endosomal antigen 1, and may be involved in the trafficking of and interaction between endosomal compartments. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:RAB22A (NM_020673) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC209511L1 Lenti ORF clone of Human RAB22A, member RAS oncogene family (RAB22A), Myc-DDK-tagged 10 ug
$600.00
RC209511L2 Lenti ORF clone of Human RAB22A, member RAS oncogene family (RAB22A), mGFP tagged 10 ug
$600.00
RC209511L3 Lenti ORF clone of Human RAB22A, member RAS oncogene family (RAB22A), Myc-DDK-tagged 10 ug
$600.00
RC209511L4 Lenti ORF clone of Human RAB22A, member RAS oncogene family (RAB22A), mGFP tagged 10 ug
$600.00
RG209511 RAB22A (tGFP-tagged) - Human RAB22A, member RAS oncogene family (RAB22A) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC108425 RAB22A (untagged)-Human RAB22A, member RAS oncogene family (RAB22A) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.