RAB22A (NM_020673) Human Recombinant Protein

SKU
TP309511
Recombinant protein of human RAB22A, member RAS oncogene family (RAB22A), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209511 protein sequence
Red=Cloning site Green=Tags(s)

MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRAL
APMYYRGSAAAIIVYDITKEETFSTLKNWVKELRQHGPPNIVVAIAGNKCDLIDVREVMERDAKDYADSI
HAIFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRSCC

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 21.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_065724
Locus ID 57403
UniProt ID Q9UL26
Cytogenetics 20q13.32
RefSeq Size 8702
RefSeq ORF 582
Summary The protein encoded by this gene is a member of the RAB family of small GTPases. The GTP-bound form of the encoded protein has been shown to interact with early-endosomal antigen 1, and may be involved in the trafficking of and interaction between endosomal compartments. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Endocytosis
Write Your Own Review
You're reviewing:RAB22A (NM_020673) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH309511 RAB22A MS Standard C13 and N15-labeled recombinant protein (NP_065724) 10 ug
$3,255.00
LC402804 RAB22A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402804 Transient overexpression lysate of RAB22A, member RAS oncogene family (RAB22A) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.