OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LSM12 (NM_152344) Human Mass Spec Standard

Be the first to review this product
SKU
PH308457
LSM12 MS Standard C13 and N15-labeled recombinant protein (NP_689557)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA338823 Rabbit Polyclonal Anti-LSM12 Antibody
100 ul
$585.00
LY407594 Transient overexpression lysate of LSM12 homolog (S. cerevisiae) (LSM12) (as WB positive control) 100 ug
$436.00

Other products for "LSM12 or NM_152344"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208457
Predicted MW 21.8 kDa
Protein Sequence
Protein Sequence
>RC208457 protein sequence
Red=Cloning site Green=Tags(s)

MAAPPGEYFSVGSQVSCRTCQEQRLQGEVVAFDYQSKMLALKCPSSSGKPNHADILLINLQYVSEVEIIN
DRTETPRPLASLNVSKLASKARTEKEEKLSQAYAISAGVSLEGQQLFQTIHKTIKDCKWQEKNIVVMEEV
VITPPYQVENCKGKEGSALSHVRKIVEKHFRDVESQKILQRSQAQQPQKEAALSS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_689557
RefSeq Size 2507
RefSeq ORF 585
Synonyms PNAS-135
Locus ID 124801
UniProt ID Q3MHD2
Cytogenetics 17q21.31
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LSM12" proteins (3)
SKU Description Size Price
LC407594 Lyophilized LSM12 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407594 Transient overexpression lysate of LSM12 homolog (S. cerevisiae) (LSM12) (as WB positive control) 100 ug
$436.00
TP308457 Recombinant protein of human LSM12 homolog (S. cerevisiae) (LSM12), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products