LSM12 (NM_152344) Human Mass Spec Standard

CAT#: PH308457

LSM12 MS Standard C13 and N15-labeled recombinant protein (NP_689557)

Product Images

Coomassie blue staining of purified LSM12 protein (Cat# TP308457). The protein was produced from HEK293T cells transfected with LSM12 cDNA clone (Cat# RC208457) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208457
• Predicted MW: 21.8 kDa
• Protein Sequence:
  Sequence Link

  >RC208457 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAPPGEYFSVGSQVSCRTCQEQRLQGEVVAFDYQSKMLALKCPSSSGKPNHADILLINLQYVSEVEIIN
  DRTETPRPLASLNVSKLASKARTEKEEKLSQAYAISAGVSLEGQQLFQTIHKTIKDCKWQEKNIVVMEEV
  VITPPYQVENCKGKEGSALSHVRKIVEKHFRDVESQKILQRSQAQQPQKEAALSS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_689557
• RefSeq Size: 2507
• RefSeq ORF: 585
• Synonyms: PNAS-135
• Locus ID: 124801
• UniProt ID: Q3MHD2
• Cytogenetics: 17q21.31