OriGene Logo

LSM12 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA338823
Rabbit Polyclonal Anti-LSM12 Antibody
Size:
100 ul
Conjugation:
Unconjugated
In Control Promo
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY407594 Transient overexpression lysate of LSM12 homolog (S. cerevisiae) (LSM12) 100 ug
$436.00
TP308457 Recombinant protein of human LSM12 homolog (S. cerevisiae) (LSM12), 20 µg
20 ug
$867.00

View other "LSM12 or NM_152344" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-LSM12 antibody: synthetic peptide directed towards the middle region of human LSM12. Synthetic peptide located within the following region: PPYQVENCKGKEGSALSHVRKIVEKHFRDVESQKILQRSQAQQPQKEAAL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 22 kDa
Gene Name LSM12 homolog
Database Link
Background LSM12 belongs to the LSM12 family. The exact function of LSM12 is not known.
Synonyms PNAS-135
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Zebrafish: 79%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
OriGene AI

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.