LSM12 (NM_152344) Human Recombinant Protein

SKU
TP308457
Recombinant protein of human LSM12 homolog (S. cerevisiae) (LSM12), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208457 protein sequence
Red=Cloning site Green=Tags(s)

MAAPPGEYFSVGSQVSCRTCQEQRLQGEVVAFDYQSKMLALKCPSSSGKPNHADILLINLQYVSEVEIIN
DRTETPRPLASLNVSKLASKARTEKEEKLSQAYAISAGVSLEGQQLFQTIHKTIKDCKWQEKNIVVMEEV
VITPPYQVENCKGKEGSALSHVRKIVEKHFRDVESQKILQRSQAQQPQKEAALSS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 21.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_689557
Locus ID 124801
UniProt ID Q3MHD2
Cytogenetics 17q21.31
RefSeq Size 2507
RefSeq ORF 585
Synonyms PNAS-135
 
 
 
 
 
Be the first to review this product
SKU Description Size Price
PH308457 LSM12 MS Standard C13 and N15-labeled recombinant protein (NP_689557) 10 ug
$3,255.00
LC407594 LSM12 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407594 Transient overexpression lysate of LSM12 homolog (S. cerevisiae) (LSM12) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.