OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Hemogen (HEMGN) (NM_018437) Human Mass Spec Standard

Be the first to review this product
SKU
PH308367
HEMGN MS Standard C13 and N15-labeled recombinant protein (NP_060907)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA800885 HEMGN mouse monoclonal antibody, clone OTI2D7 (formerly 2D7) 100 ul
$447.00
LY402697 Transient overexpression lysate of hemogen (HEMGN), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "Hemogen or NM_018437"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208367
Predicted MW 55.3 kDa
Protein Sequence
Protein Sequence
>RC208367 protein sequence
Red=Cloning site Green=Tags(s)

MDLGKDQSHLKHHQTPDPHQEENHSPEVIGTWSLRNRELLRKRKAEVHEKETSQWLFGEQKKRKQQRTGK
GNRRGRKRQQNTELKVEPQPQIEKEMEKALAPIEKKTEPPGSITKVFPSVASPQKVVPEEHFSEICQESN
IYQENFSEYQEIAVQNHSSETCQHVSEPEDLSPKMYQEISVLQDNSSKICQDMKEPEDNSPNTCQVISVI
QDHPFKMYQDMAKREDLAPKMCQEAAVPKILPCPTSEDTADLAGCSLQAYPKPDVPKGYILDTDQNPAEP
EEYNETDQGIAETEGLFPKIQEIAEPKDLSTKTHQESAEPKYLPHKTCNEIIVPKAPSHKTIQETPHSED
YSIEINQETPGSEKYSPETYQEIPGLEEYSPEIYQETSQLEEYSPEIYQETPGPEDLSTETYKNKDVPKE
CFPEPHQETGGPQGQDPKAHQEDAKDAYTFPQEMKEKPKEEPGIPAILNESHPENDVYSYVLF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060907
RefSeq Size 2252
RefSeq ORF 1449
Synonyms CT155; EDAG; EDAG-1; NDR
Locus ID 55363
UniProt ID Q9BXL5
Cytogenetics 9q22.33
Summary Regulates the proliferation and differentiation of hematopoietic cells. Overexpression block the TPA-induced megakaryocytic differentiation in the K562 cell model. May also prevent cell apoptosis through the activation of the nuclear factor-kappa B (NF-kB).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Hemogen" proteins (7)
SKU Description Size Price
PH314122 HEMGN MS Standard C13 and N15-labeled recombinant protein (NP_932095) 10 ug
$3,360.00
LC402697 Lyophilized HEMGN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405099 Lyophilized HEMGN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402697 Transient overexpression lysate of hemogen (HEMGN), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY405099 Transient overexpression lysate of hemogen (HEMGN), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP308367 Recombinant protein of human hemogen (HEMGN), transcript variant 1, 20 µg 20 ug
$737.00
TP314122 Recombinant protein of human hemogen (HEMGN), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products