OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

E2F1 (NM_005225) Human Mass Spec Standard

Be the first to review this product
SKU
PH308247
E2F1 MS Standard C13 and N15-labeled recombinant protein (NP_005216)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA590609 Rabbit Polyclonal E2F1 Antibody
100 ug
$482.00
LY417432 Transient overexpression lysate of E2F transcription factor 1 (E2F1) (as WB positive control) 100 ug
$436.00

Other products for "E2F1 or NM_005225"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208247
Predicted MW 46.7 kDa
Protein Sequence
Protein Sequence
>RC208247 representing NM_005225
Red=Cloning site Green=Tags(s)

MALAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISAAQDASAPPAPTGPAAPAAGPCDPDLLLFATPQ
APRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVKSPGEKSRYETSLNLTTKRFL
ELLSHSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLIAKKSKNHIQWLGSHTTVGVGGRLEGLTQDL
RQLQESEQQLDHLMNICTTQLRLLSEDTDSQRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSE
NFQISLKSKQGPIDVFLCPEETVGGISPGKTPSQEVTSEEENRATDSATIVSPPPSSPPSSLTTDPSQSL
LSLEQEPLLSRMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEG
IRDLFDCDFGDLTPLDF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005216
RefSeq Size 2486
RefSeq ORF 1311
Synonyms E2F-1; RBAP1; RBBP3; RBP3
Locus ID 1869
UniProt ID Q01094
Cytogenetics 20q11.22
Summary The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F2 and E2F3, have an additional cyclin binding domain. This protein binds preferentially to retinoblastoma protein pRB in a cell-cycle dependent manner. It can mediate both cell proliferation and p53-dependent/independent apoptosis. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Bladder cancer, Cell cycle, Chronic myeloid leukemia, Glioma, Melanoma, Non-small cell lung cancer, Pancreatic cancer, Pathways in cancer, Prostate cancer, Small cell lung cancer
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "E2F1" proteins (3)
SKU Description Size Price
LC417432 Lyophilized E2F1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417432 Transient overexpression lysate of E2F transcription factor 1 (E2F1) (as WB positive control) 100 ug
$436.00
TP308247 Recombinant protein of human E2F transcription factor 1 (E2F1), 20 µg 20 ug
$867.00

file-alt Citations

Non-overlapping Control of Transcriptome by Promoter- and Super-Enhancer-Associated Dependencies in Multiple Myeloma
Fulciniti, Lin, Samur et al
Cell Rep (2018) 25 (13), 3693-3705.e6 DOI: 10.1016/j.celrep.2018.12.016
AI Summary: OriGene’s E2F1 (NM_005225) Human Tagged ORF Clone (RC208247L2) was used in this study to investigate the role of E2F1 in multiple myeloma, enabling functional analysis of E2F1’s contribution to distinct transcriptional regulatory programs.
Snippet: ;TRIPZ Human E2F1 shRNA V2THS_43498 Thermo Scientific Bio RHS4696-200701670 E2F1 (NM_005225) Human Tagged ORF Clone Origene RC208247L2
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products