OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CPA5 (NM_080385) Human Mass Spec Standard

Be the first to review this product
SKU
PH307397
CPA5 MS Standard C13 and N15-labeled recombinant protein (NP_525124)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA326258 Rabbit polyclonal CPA5 antibody
100 ul
$380.00
LY409210 Transient overexpression lysate of carboxypeptidase A5 (CPA5), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "CPA5 or NM_080385"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207397
Predicted MW 49 kDa
Protein Sequence
Protein Sequence
>RC207397 protein sequence
Red=Cloning site Green=Tags(s)

MQGTPGGGTRPGPSPVDRRTLLVFSFILAAALGQMNFTGDQVLRVLAKDEKQLSLLGDLEGLKPQKVDFW
RGPARPSLPVDMRVPFSELKDIKAYLESHGLAYSIMIKDIQVLLDEERQAMAKSRRLERSTNSFSYSSYH
TLEEIYSWIDNFVMEHSDIVSKIQIGNSFENQSILVLKFSTGGSRHPAIWIDTGIHSREWITHATGIWTA
NKIVSDYGKDRVLTDILNAMDIFIELVTNPDGFAFTHSMNRLWRKNKSIRPGIFCIGVDLNRNWKSGFGG
NGSNSNPCSETYHGPSPQSEPEVAAIVNFITAHGNFKALISIHSYSQMLMYPYGRSLDPVSNQRELYDLA
KDAVEALYKVHGIEYIFGSISTTLYVASGITVDWAYDSGIKYAFSFELRDTGQYGFLLPATQIIPTAQET
WMALRTIMEHTLNHPY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_525124
RefSeq Size 2078
RefSeq ORF 1308
Locus ID 93979
UniProt ID Q8WXQ8
Cytogenetics 7q32.2
Summary Carboxypeptidases have functions ranging from digestion of food to selective biosynthesis of neuroendocrine peptides. Members of the A/B subfamily of carboxypeptidases, such as CPA5, contain an approximately 90-amino acid pro region that assists in the folding of the active carboxypeptidase domain. Cleavage of the pro region activates the enzyme (Wei et al., 2002 PubMed 11836249).supplied by OMIM, Mar 2008
Protein Families Druggable Genome, Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CPA5" proteins (7)
SKU Description Size Price
LC409210 Lyophilized CPA5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426784 Lyophilized CPA5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426785 Lyophilized CPA5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409210 Transient overexpression lysate of carboxypeptidase A5 (CPA5), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY426784 Transient overexpression lysate of carboxypeptidase A5 (CPA5), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY426785 Transient overexpression lysate of carboxypeptidase A5 (CPA5), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP307397 Recombinant protein of human carboxypeptidase A5 (CPA5), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products