CPA5 (NM_080385) Human Recombinant Protein

SKU
TP307397
Recombinant protein of human carboxypeptidase A5 (CPA5), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC207397 protein sequence
Red=Cloning site Green=Tags(s)

MQGTPGGGTRPGPSPVDRRTLLVFSFILAAALGQMNFTGDQVLRVLAKDEKQLSLLGDLEGLKPQKVDFW
RGPARPSLPVDMRVPFSELKDIKAYLESHGLAYSIMIKDIQVLLDEERQAMAKSRRLERSTNSFSYSSYH
TLEEIYSWIDNFVMEHSDIVSKIQIGNSFENQSILVLKFSTGGSRHPAIWIDTGIHSREWITHATGIWTA
NKIVSDYGKDRVLTDILNAMDIFIELVTNPDGFAFTHSMNRLWRKNKSIRPGIFCIGVDLNRNWKSGFGG
NGSNSNPCSETYHGPSPQSEPEVAAIVNFITAHGNFKALISIHSYSQMLMYPYGRSLDPVSNQRELYDLA
KDAVEALYKVHGIEYIFGSISTTLYVASGITVDWAYDSGIKYAFSFELRDTGQYGFLLPATQIIPTAQET
WMALRTIMEHTLNHPY

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 48.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_525124
Locus ID 93979
UniProt ID Q8WXQ8
Cytogenetics 7q32.2
RefSeq Size 2078
RefSeq ORF 1308
Summary Carboxypeptidases have functions ranging from digestion of food to selective biosynthesis of neuroendocrine peptides. Members of the A/B subfamily of carboxypeptidases, such as CPA5, contain an approximately 90-amino acid pro region that assists in the folding of the active carboxypeptidase domain. Cleavage of the pro region activates the enzyme (Wei et al., 2002 [PubMed 11836249]).[supplied by OMIM, Mar 2008]
Protein Families Druggable Genome, Secreted Protein
Write Your Own Review
You're reviewing:CPA5 (NM_080385) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH307397 CPA5 MS Standard C13 and N15-labeled recombinant protein (NP_525124) 10 ug
$3,255.00
LC409210 CPA5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426784 CPA5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426785 CPA5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409210 Transient overexpression lysate of carboxypeptidase A5 (CPA5), transcript variant 1 100 ug
$436.00
LY426784 Transient overexpression lysate of carboxypeptidase A5 (CPA5), transcript variant 2 100 ug
$436.00
LY426785 Transient overexpression lysate of carboxypeptidase A5 (CPA5), transcript variant 3 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.