ALG1 (NM_019109) Human Mass Spec Standard

CAT#: PH306343

ALG1 MS Standard C13 and N15-labeled recombinant protein (NP_061982)

Product Images

Coomassie blue staining of purified ALG1 protein (Cat# TP306343). The protein was produced from HEK293T cells transfected with ALG1 cDNA clone (Cat# RC206343) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206343
• Predicted MW: 52.6 kDa
• Protein Sequence:
  Sequence Link

  >RC206343 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAASCLVLLALCLLLPLLLLGGWKRWRRGRAARHVVAVVLGDVGRSPRMQYHALSLAMHGFSVTLLGFCN
  SKPHDELLQNNRIQIVGLTELQSLAVGPRVFQYGVKVVLQAMYLLWKLMWREPGAYIFLQNPPGLPSIAV
  CWFVGCLCGSKLVIDWHNYGYSIMGLVHGPNHPLVLLAKWYEKFFGRLSHLNLCVTNAMREDLADNWHIR
  AVTVYDKPASFFKETPLDLQHRLFMKLGSMHSPFRARSEPEDPVTERSAFTERDAGSGLVTRLRERPALL
  VSSTSWTEDEDFSILLAALEKFEQLTLDGHNLPSLVCVITGKGPMREYYSRLIHQKHFQHIQVCTPWLEA
  EDYPLLLGSADLGVCLHTSSSGLDLPMKVVDMFGCCLPVCAVNFKCLHELVKHEENGLVFEDSEELAAQL
  QMLFSNFPDPAGKLNQFRKNLRESQQLRWDESWVRTVLPLVMDT
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_061982
• RefSeq Size: 3946
• RefSeq ORF: 1392
• Synonyms: CDG1K; hMat-1; HMAT1; HMT-1; HMT1; Mat-1; MT-1
• Locus ID: 56052
• UniProt ID: Q9BT22
• Cytogenetics: 16p13.3
• Summary: The enzyme encoded by this gene catalyzes the first mannosylation step in the biosynthesis of lipid-linked oligosaccharides. This gene is mutated in congenital disorder of glycosylation type Ik. [provided by RefSeq, Dec 2008]
• Protein Families: Transmembrane
• Protein Pathways: Metabolic pathways, N-Glycan biosynthesis