ALG1 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-ALG1 antibody: synthetic peptide directed towards the N terminal of human ALG1. Synthetic peptide located within the following region: VVLGDVGRSPRMQYHALSLAMHGFSVTLLGFCNSKPHDELLQNNRIQIVG |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 52 kDa |
| Gene Name | ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase |
| Database Link | |
| Background | ALG1 catalyzes the first mannosylation step in the biosynthesis of lipid-linked oligosaccharides. Defects in ALG1 are the cause of congenital disorder of glycosylation type 1K (CDG1K).The biosynthesis of lipid-linked oligosaccharides is highly conserved among eukaryotes and is catalyzed by 14 glycosyltransferases in an ordered stepwise manner. Mannosyltransferase I (MT I) catalyzes the first mannosylation step in this process. supplied by OMIM. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-421 BM767933.1 1-421 422-1179 AY359073.1 416-1173 1180-1444 CA455103.1 259-523 1445-1939 CD366777.1 17-511 c 1940-2122 BC031095.1 1931-2113 2123-2149 BQ002699.1 1-27 c |
| Synonyms | CDG1K; hMat-1; HMAT1; HMT-1; HMT1; Mat-1; MT-1 |
| Note | Human: 100%; Yeast: 100%; Mouse: 85%; Rat: 79%; Bovine: 79%; Rabbit: 79% |
| Reference Data | |
| Protein Categories | Intracellular Proteins, Membrane Proteins |
| Protein Families | Transmembrane |
| Protein Pathways | Metabolic pathways, N-Glycan biosynthesis |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
