OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Alkaline Phosphatase (ALPL) (NM_000478) Human Mass Spec Standard

Be the first to review this product
SKU
PH305692
ALPL MS Standard C13 and N15-labeled recombinant protein (NP_000469)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY400165 Transient overexpression lysate of alkaline phosphatase, liver/bone/kidney (ALPL), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "Alkaline Phosphatase or NM_000478"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205692
Predicted MW 57.3 kDa
Protein Sequence
Protein Sequence
>RC205692 protein sequence
Red=Cloning site Green=Tags(s)

MISPFLVLAIGTCLTNSLVPEKEKDPKYWRDQAQETLKYALELQKLNTNVAKNVIMFLGDGMGVSTVTAA
RILKGQLHHNPGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCGVKANEGTVGVSAATERSRCN
TTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSAAYAHSADRDWYSDNEMPPEALSQGCKDIAYQLMH
NIRDIDVIMGGGRKYMYPKNKTDVEYESDEKARGTRLDGLDLVDTWKSFKPRYKHSHFIWNRTELLTLDP
HNVDYLLGLFEPGDMQYELNRNNVTDPSLSEMVVVAIQILRKNPKGFFLLVEGGRIDHGHHEGKAKQALH
EAVEMDRAIGQAGSLTSSEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMLSDTDKKPFTAILYGNGPG
YKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFSKGPMAHLLHGVHEQNYVPHVMAYAACI
GANLGHCAPASSAGSLAAGPLLLALALYPLSVLF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000469
RefSeq Size 2606
RefSeq ORF 1572
Synonyms AP-TNAP; APTNAP; HOPS; HPPA; HPPC; HPPI; HPPO; TNALP; TNAP; TNSALP
Locus ID 249
UniProt ID P05186
Cytogenetics 1p36.12
Summary This gene encodes a member of the alkaline phosphatase family of proteins. There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The first three are located together on chromosome 2, while the tissue non-specific form is located on chromosome 1. The product of this gene is a membrane bound glycosylated enzyme that is not expressed in any particular tissue and is, therefore, referred to as the tissue-nonspecific form of the enzyme. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature enzyme. This enzyme may play a role in bone mineralization. Mutations in this gene have been linked to hypophosphatasia, a disorder that is characterized by hypercalcemia and skeletal defects. provided by RefSeq, Oct 2015
Protein Families Druggable Genome
Protein Pathways Folate biosynthesis, Metabolic pathways
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Alkaline Phosphatase" proteins (9)
SKU Description Size Price
LC400165 Lyophilized ALPL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426804 Lyophilized ALPL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC433101 Lyophilized ALPL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400165 Transient overexpression lysate of alkaline phosphatase, liver/bone/kidney (ALPL), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY426804 Transient overexpression lysate of alkaline phosphatase, liver/bone/kidney (ALPL), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY433101 Transient overexpression lysate of alkaline phosphatase, liver/bone/kidney (ALPL), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP305692 Recombinant protein of human alkaline phosphatase, liver/bone/kidney (ALPL), transcript variant 1, 20 µg 20 ug
$867.00
TP720457 Recombinant protein of human alkaline phosphatase, liver/bone/kidney (ALPL), transcript variant 1 10 ug
$340.00
TP760508 Purified recombinant protein of Human alkaline phosphatase, liver/bone/kidney (ALPL), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products