Alkaline Phosphatase (ALPL) (NM_000478) Human Recombinant Protein

SKU
TP305692
Recombinant protein of human alkaline phosphatase, liver/bone/kidney (ALPL), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
5 Days*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC205692 protein sequence
Red=Cloning site Green=Tags(s)

MISPFLVLAIGTCLTNSLVPEKEKDPKYWRDQAQETLKYALELQKLNTNVAKNVIMFLGDGMGVSTVTAA
RILKGQLHHNPGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCGVKANEGTVGVSAATERSRCN
TTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSAAYAHSADRDWYSDNEMPPEALSQGCKDIAYQLMH
NIRDIDVIMGGGRKYMYPKNKTDVEYESDEKARGTRLDGLDLVDTWKSFKPRYKHSHFIWNRTELLTLDP
HNVDYLLGLFEPGDMQYELNRNNVTDPSLSEMVVVAIQILRKNPKGFFLLVEGGRIDHGHHEGKAKQALH
EAVEMDRAIGQAGSLTSSEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMLSDTDKKPFTAILYGNGPG
YKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFSKGPMAHLLHGVHEQNYVPHVMAYAACI
GANLGHCAPASSAGSLAAGPLLLALALYPLSVLF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 55.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000469
Locus ID 249
UniProt ID P05186
Cytogenetics 1p36.12
RefSeq Size 2606
RefSeq ORF 1572
Synonyms AP-TNAP; APTNAP; HOPS; HPPA; HPPC; HPPI; HPPO; TNALP; TNAP; TNSALP
Summary This gene encodes a member of the alkaline phosphatase family of proteins. There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The first three are located together on chromosome 2, while the tissue non-specific form is located on chromosome 1. The product of this gene is a membrane bound glycosylated enzyme that is not expressed in any particular tissue and is, therefore, referred to as the tissue-nonspecific form of the enzyme. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature enzyme. This enzyme may play a role in bone mineralization. Mutations in this gene have been linked to hypophosphatasia, a disorder that is characterized by hypercalcemia and skeletal defects. [provided by RefSeq, Oct 2015]
Protein Families Druggable Genome
Protein Pathways Folate biosynthesis, Metabolic pathways
Write Your Own Review
You're reviewing:Alkaline Phosphatase (ALPL) (NM_000478) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH305692 ALPL MS Standard C13 and N15-labeled recombinant protein (NP_000469) 10 ug
$3,255.00
LC400165 ALPL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426804 ALPL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC433101 ALPL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400165 Transient overexpression lysate of alkaline phosphatase, liver/bone/kidney (ALPL), transcript variant 1 100 ug
$436.00
LY426804 Transient overexpression lysate of alkaline phosphatase, liver/bone/kidney (ALPL), transcript variant 2 100 ug
$436.00
LY433101 Transient overexpression lysate of alkaline phosphatase, liver/bone/kidney (ALPL), transcript variant 3 100 ug
$436.00
TP720457 Recombinant protein of human alkaline phosphatase, liver/bone/kidney (ALPL), transcript variant 1 10 ug
$330.00
TP760508 Purified recombinant protein of Human alkaline phosphatase, liver/bone/kidney (ALPL), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.