Alkaline Phosphatase (ALPL) (NM_000478) Human Mass Spec Standard

SKU
PH305692
ALPL MS Standard C13 and N15-labeled recombinant protein (NP_000469)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205692]
Predicted MW 57.3 kDa
Protein Sequence
Protein Sequence
>RC205692 protein sequence
Red=Cloning site Green=Tags(s)

MISPFLVLAIGTCLTNSLVPEKEKDPKYWRDQAQETLKYALELQKLNTNVAKNVIMFLGDGMGVSTVTAA
RILKGQLHHNPGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCGVKANEGTVGVSAATERSRCN
TTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSAAYAHSADRDWYSDNEMPPEALSQGCKDIAYQLMH
NIRDIDVIMGGGRKYMYPKNKTDVEYESDEKARGTRLDGLDLVDTWKSFKPRYKHSHFIWNRTELLTLDP
HNVDYLLGLFEPGDMQYELNRNNVTDPSLSEMVVVAIQILRKNPKGFFLLVEGGRIDHGHHEGKAKQALH
EAVEMDRAIGQAGSLTSSEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMLSDTDKKPFTAILYGNGPG
YKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFSKGPMAHLLHGVHEQNYVPHVMAYAACI
GANLGHCAPASSAGSLAAGPLLLALALYPLSVLF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000469
RefSeq Size 2606
RefSeq ORF 1572
Synonyms AP-TNAP; APTNAP; HOPS; HPPA; HPPC; HPPI; HPPO; TNALP; TNAP; TNSALP
Locus ID 249
UniProt ID P05186
Cytogenetics 1p36.12
Summary This gene encodes a member of the alkaline phosphatase family of proteins. There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The first three are located together on chromosome 2, while the tissue non-specific form is located on chromosome 1. The product of this gene is a membrane bound glycosylated enzyme that is not expressed in any particular tissue and is, therefore, referred to as the tissue-nonspecific form of the enzyme. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature enzyme. This enzyme may play a role in bone mineralization. Mutations in this gene have been linked to hypophosphatasia, a disorder that is characterized by hypercalcemia and skeletal defects. [provided by RefSeq, Oct 2015]
Protein Families Druggable Genome
Protein Pathways Folate biosynthesis, Metabolic pathways
Write Your Own Review
You're reviewing:Alkaline Phosphatase (ALPL) (NM_000478) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400165 ALPL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426804 ALPL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC433101 ALPL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400165 Transient overexpression lysate of alkaline phosphatase, liver/bone/kidney (ALPL), transcript variant 1 100 ug
$436.00
LY426804 Transient overexpression lysate of alkaline phosphatase, liver/bone/kidney (ALPL), transcript variant 2 100 ug
$436.00
LY433101 Transient overexpression lysate of alkaline phosphatase, liver/bone/kidney (ALPL), transcript variant 3 100 ug
$436.00
TP305692 Recombinant protein of human alkaline phosphatase, liver/bone/kidney (ALPL), transcript variant 1, 20 µg 20 ug
$867.00
TP720457 Recombinant protein of human alkaline phosphatase, liver/bone/kidney (ALPL), transcript variant 1 10 ug
$330.00
TP760508 Purified recombinant protein of Human alkaline phosphatase, liver/bone/kidney (ALPL), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.