OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Thymidylate Synthase (TYMS) (NM_001071) Human Mass Spec Standard

Be the first to review this product
SKU
PH304814
TYMS MS Standard C13 and N15-labeled recombinant protein (NP_001062)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA801551 TYMS mouse monoclonal antibody, clone OTI10F12 (formerly 10F12) 100 ul
$447.00
LY420700 Transient overexpression lysate of thymidylate synthetase (TYMS) (as WB positive control) 100 ug
$436.00

Other products for "Thymidylate Synthase or NM_001071"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204814
Predicted MW 35.5 kDa
Protein Sequence
Protein Sequence
>RC204814 representing NM_001071
Red=Cloning site Green=Tags(s)

MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDE
FPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWR
HFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSC
QLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLR
ILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001062
RefSeq Size 1536
RefSeq ORF 939
Synonyms HST422; TMS; TS
Locus ID 7298
UniProt ID P04818
Cytogenetics 18p11.32
Summary Thymidylate synthase catalyzes the methylation of deoxyuridylate to deoxythymidylate using, 10-methylenetetrahydrofolate (methylene-THF) as a cofactor. This function maintains the dTMP (thymidine-5-prime monophosphate) pool critical for DNA replication and repair. The enzyme has been of interest as a target for cancer chemotherapeutic agents. It is considered to be the primary site of action for 5-fluorouracil, 5-fluoro-2-prime-deoxyuridine, and some folate analogs. Expression of this gene and that of a naturally occurring antisense transcript, mitochondrial enolase superfamily member 1 (GeneID:55556), vary inversely when cell-growth progresses from late-log to plateau phase. Polymorphisms in this gene may be associated with etiology of neoplasia, including breast cancer, and response to chemotherapy. provided by RefSeq, Aug 2017
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, One carbon pool by folate, Pyrimidine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Thymidylate Synthase" proteins (4)
SKU Description Size Price
LC420700 Lyophilized TYMS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY420700 Transient overexpression lysate of thymidylate synthetase (TYMS) (as WB positive control) 100 ug
$436.00
TP304814 Recombinant protein of human thymidylate synthetase (TYMS), 20 µg 20 ug
$737.00
TP710029 Recombinant protein of human thymidylate synthetase (TYMS), full length, with N-terminal polyhistidine tag, expressed in sf9 cells. 20 ug
$540.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products