OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Thymidylate Synthase (TYMS) (NM_001071) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC204814
TYMS (Myc-DDK-tagged)-Human thymidylate synthetase (TYMS)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
  $450.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA801551 TYMS mouse monoclonal antibody, clone OTI10F12 (formerly 10F12) 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Thymidylate Synthase or NM_001071"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Thymidylate Synthase
Synonyms HST422; TMS; TS
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204814 representing NM_001071
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTGTGGCCGGCTCGGAGCTGCCGCGCCGGCCCTTGCCCCCCGCCGCACAGGAGCGGGACGCCGAGC
CGCGTCCGCCGCACGGGGAGCTGCAGTACCTGGGGCAGATCCAACACATCCTCCGCTGCGGCGTCAGGAA
GGACGACCGCACGGGCACCGGCACCCTGTCGGTATTCGGCATGCAGGCGCGCTACAGCCTGAGAGATGAA
TTCCCTCTGCTGACAACCAAACGTGTGTTCTGGAAGGGTGTTTTGGAGGAGTTGCTGTGGTTTATCAAGG
GATCCACAAATGCTAAAGAGCTGTCTTCCAAGGGAGTGAAAATCTGGGATGCCAATGGATCCCGAGACTT
TTTGGACAGCCTGGGATTCTCCACCAGAGAAGAAGGGGACTTGGGCCCAGTTTATGGCTTCCAGTGGAGG
CATTTTGGGGCAGAATACAGAGATATGGAATCAGATTATTCAGGACAGGGAGTTGACCAACTGCAAAGAG
TGATTGACACCATCAAAACCAACCCTGACGACAGAAGAATCATCATGTGCGCTTGGAATCCAAGAGATCT
TCCTCTGATGGCGCTGCCTCCATGCCATGCCCTCTGCCAGTTCTATGTGGTGAACAGTGAGCTGTCCTGC
CAGCTGTACCAGAGATCGGGAGACATGGGCCTCGGTGTGCCTTTCAACATCGCCAGCTACGCCCTGCTCA
CGTACATGATTGCGCACATCACGGGCCTGAAGCCAGGTGACTTTATACACACTTTGGGAGATGCACATAT
TTACCTGAATCACATCGAGCCACTGAAAATTCAGCTTCAGCGAGAACCCAGACCTTTCCCAAAGCTCAGG
ATTCTTCGAAAAGTTGAGAAAATTGATGACTTCAAAGCTGAAGACTTTCAGATTGAAGGGTACAATCCGC
ATCCAACTATTAAAATGGAAATGGCTGTT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC204814 representing NM_001071
Red=Cloning site Green=Tags(s)

MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDE
FPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWR
HFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSC
QLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLR
ILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001071
ORF Size 939 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001071.4
RefSeq Size 1536 bp
RefSeq ORF 942 bp
Locus ID 7298
UniProt ID P04818
Cytogenetics 18p11.32
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, One carbon pool by folate, Pyrimidine metabolism
MW 35.5 kDa
Summary Thymidylate synthase catalyzes the methylation of deoxyuridylate to deoxythymidylate using, 10-methylenetetrahydrofolate (methylene-THF) as a cofactor. This function maintains the dTMP (thymidine-5-prime monophosphate) pool critical for DNA replication and repair. The enzyme has been of interest as a target for cancer chemotherapeutic agents. It is considered to be the primary site of action for 5-fluorouracil, 5-fluoro-2-prime-deoxyuridine, and some folate analogs. Expression of this gene and that of a naturally occurring antisense transcript, mitochondrial enolase superfamily member 1 (GeneID:55556), vary inversely when cell-growth progresses from late-log to plateau phase. Polymorphisms in this gene may be associated with etiology of neoplasia, including breast cancer, and response to chemotherapy. provided by RefSeq, Aug 2017
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001071" in other vectors (6)
SKU Description Size Price
RC204814L1 Lenti ORF clone of Human thymidylate synthetase (TYMS), Myc-DDK-tagged 10 ug
$750.00
RC204814L2 Lenti ORF clone of Human thymidylate synthetase (TYMS), mGFP tagged 10 ug
$750.00
RC204814L3 Lenti ORF clone of Human thymidylate synthetase (TYMS), Myc-DDK-tagged 10 ug
$750.00
RC204814L4 Lenti ORF clone of Human thymidylate synthetase (TYMS), mGFP tagged 10 ug
$750.00
RG204814 TYMS (tGFP-tagged) - Human thymidylate synthetase (TYMS) 10 ug
$650.00
SC319762 TYMS (untagged)-Human thymidylate synthetase (TYMS) 10 ug
$450.00

Plasmid Map for RC204814

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC204814
Circular map for RC204814

file-alt Citations

Destabilizers of the thymidylate synthase homodimer accelerate its proteasomal degradation and inhibit cancer growth
Costantino, Ferrari, Santucci et al
Elife (2022) 11 DOI: 10.7554/eLife.73862
AI Summary: In this study, the OriGene Human thymidylate synthase (TYMS)-Myc-DDK-tagged vector (OriGene RC204814) was used to generate a mutant form of hTS, enabling the investigation of dimer destabilizers’ effects on enzyme degradation and cancer growth inhibition.
Snippet: cDNA from Quantitative-PCR Human-Reference Total-RNA (Stratagene), as described previously (Zucali et al., 2011). hTS-F59A mutant generation Human thymidylate synthase (TYMS)-Myc-DDK-tagged vector (Origene RC204814) was used to generate a hTS-F59A mutant. hTS mutations were introduced by PCR, using the GENEART Site-Directed Mutagenesis System (Invitrogen). The mutagenic oligonucleotides used wer
FigureFigureFigure
DHFR/TYMS are positive regulators of glioma cell growth and modulate chemo-sensitivity to temozolomide
Zhao, Tan, Dai et al
Eur. J. Pharmacol. (2019) 863, 172665 DOI: 10.1016/j.ejphar.2019.172665
AI Summary: OriGene products, including wild type DHFR and TYMS expression plasmids, DHFR and TYMS siRNA, and AMPKa shRNA, were used in this study to manipulate gene expression and investigate the roles of these genes in glioma cell growth and sensitivity to temozolomide.
Snippet: 2.5. Plasmids and transfection. The plasmids that express wild type DHFR or TYMS, DHFR, TYMS siRNA and AMPKa shRNA (all were purchased from Origene) were transfected into cells by Lipofectamine (2000) (Invitrogen) according to the manufacturer's protocol;
Identification of a de novo thymidylate biosynthesis pathway in mammalian mitochondria
Anderson, Quintero, Stover
PNAS (2011) 108 (37), 15163-8 DOI: 10.1073/pnas.1103623108
Cited by 196
AI Summary: OriGene products contributed to this study by providing the pCMV6-AC-GFP vector, which was used to create TYMS and DHFRL1 cDNA-GFP fusion constructs for localization studies in mammalian cells.
Snippet: TYMS and DHFRL1 cDNAs were fused to the N terminus of GFP within the pCMV6-AC-GFP vector (Origene). ... To determine if DHFRL1 was present in mitochondria and knocked down in the siRNA-treated samples, immunoblots were performed using a mouse polyclonal
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products