Thymidylate Synthase (TYMS) (NM_001071) Human Tagged ORF Clone

SKU
RC204814
TYMS (Myc-DDK-tagged)-Human thymidylate synthetase (TYMS)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$450.00
In Stock*
Specifications
Product Data
Target Symbol Thymidylate Synthase
Synonyms HST422; TMS; TS
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204814 representing NM_001071
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTGTGGCCGGCTCGGAGCTGCCGCGCCGGCCCTTGCCCCCCGCCGCACAGGAGCGGGACGCCGAGC
CGCGTCCGCCGCACGGGGAGCTGCAGTACCTGGGGCAGATCCAACACATCCTCCGCTGCGGCGTCAGGAA
GGACGACCGCACGGGCACCGGCACCCTGTCGGTATTCGGCATGCAGGCGCGCTACAGCCTGAGAGATGAA
TTCCCTCTGCTGACAACCAAACGTGTGTTCTGGAAGGGTGTTTTGGAGGAGTTGCTGTGGTTTATCAAGG
GATCCACAAATGCTAAAGAGCTGTCTTCCAAGGGAGTGAAAATCTGGGATGCCAATGGATCCCGAGACTT
TTTGGACAGCCTGGGATTCTCCACCAGAGAAGAAGGGGACTTGGGCCCAGTTTATGGCTTCCAGTGGAGG
CATTTTGGGGCAGAATACAGAGATATGGAATCAGATTATTCAGGACAGGGAGTTGACCAACTGCAAAGAG
TGATTGACACCATCAAAACCAACCCTGACGACAGAAGAATCATCATGTGCGCTTGGAATCCAAGAGATCT
TCCTCTGATGGCGCTGCCTCCATGCCATGCCCTCTGCCAGTTCTATGTGGTGAACAGTGAGCTGTCCTGC
CAGCTGTACCAGAGATCGGGAGACATGGGCCTCGGTGTGCCTTTCAACATCGCCAGCTACGCCCTGCTCA
CGTACATGATTGCGCACATCACGGGCCTGAAGCCAGGTGACTTTATACACACTTTGGGAGATGCACATAT
TTACCTGAATCACATCGAGCCACTGAAAATTCAGCTTCAGCGAGAACCCAGACCTTTCCCAAAGCTCAGG
ATTCTTCGAAAAGTTGAGAAAATTGATGACTTCAAAGCTGAAGACTTTCAGATTGAAGGGTACAATCCGC
ATCCAACTATTAAAATGGAAATGGCTGTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204814 representing NM_001071
Red=Cloning site Green=Tags(s)

MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDE
FPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWR
HFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSC
QLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLR
ILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001071
ORF Size 939 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001071.4
RefSeq Size 1536 bp
RefSeq ORF 942 bp
Locus ID 7298
UniProt ID P04818
Cytogenetics 18p11.32
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, One carbon pool by folate, Pyrimidine metabolism
MW 35.5 kDa
Summary Thymidylate synthase catalyzes the methylation of deoxyuridylate to deoxythymidylate using, 10-methylenetetrahydrofolate (methylene-THF) as a cofactor. This function maintains the dTMP (thymidine-5-prime monophosphate) pool critical for DNA replication and repair. The enzyme has been of interest as a target for cancer chemotherapeutic agents. It is considered to be the primary site of action for 5-fluorouracil, 5-fluoro-2-prime-deoxyuridine, and some folate analogs. Expression of this gene and that of a naturally occurring antisense transcript, mitochondrial enolase superfamily member 1 (GeneID:55556), vary inversely when cell-growth progresses from late-log to plateau phase. Polymorphisms in this gene may be associated with etiology of neoplasia, including breast cancer, and response to chemotherapy. [provided by RefSeq, Aug 2017]
Write Your Own Review
You're reviewing:Thymidylate Synthase (TYMS) (NM_001071) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204814L1 Lenti ORF clone of Human thymidylate synthetase (TYMS), Myc-DDK-tagged 10 ug
$750.00
RC204814L2 Lenti ORF clone of Human thymidylate synthetase (TYMS), mGFP tagged 10 ug
$750.00
RC204814L3 Lenti ORF clone of Human thymidylate synthetase (TYMS), Myc-DDK-tagged 10 ug
$750.00
RC204814L4 Lenti ORF clone of Human thymidylate synthetase (TYMS), mGFP tagged 10 ug
$750.00
RG204814 TYMS (tGFP-tagged) - Human thymidylate synthetase (TYMS) 10 ug
$650.00
SC319762 TYMS (untagged)-Human thymidylate synthetase (TYMS) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.