RAB37 (NM_001006638) Human Mass Spec Standard

CAT#: PH304510

RAB37 MS Standard C13 and N15-labeled recombinant protein (NP_001006639)

Product Images

Coomassie blue staining of purified RAB37 protein (Cat# TP304510). The protein was produced from HEK293T cells transfected with RAB37 cDNA clone (Cat# RC204510) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204510
• Predicted MW: 24.8 kDa
• Protein Sequence:
  Sequence Link

  >RC204510 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTGTPGAVATRDGEAPERSPPCSPSYDLTGKVMLLGDTGVGKTCFLIQFKDGAFLSGTFIATVGIDFRNK
  VVTVDGVRVKLQIWDTAGQERFRSVTHAYYRDAQALLLLYDITNKSSFDNIRAWLTEIHEYAQRDVVIML
  LGNKADMSSERVIRSEDGETLAREYGVPFLETSAKTGMNVELAFLAIAKELKYRAGHQADEPSFQIRDYV
  ESQKKRSSCCSFM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001006639
• RefSeq Size: 2698
• RefSeq ORF: 669
• Locus ID: 326624
• UniProt ID: Q96AX2, A0A024R8K6
• Cytogenetics: 17q25.1
• Summary: Rab proteins are low molecular mass GTPases that are critical regulators of vesicle trafficking. For additional background information on Rab proteins, see MIM 179508.[supplied by OMIM, Apr 2006]
• Protein Families: Druggable Genome, Secreted Protein