RAB37 (NM_175738) Human Mass Spec Standard

SKU
PH306946
RAB37 MS Standard C13 and N15-labeled recombinant protein (NP_783865)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206946]
Predicted MW 24.2 kDa
Protein Sequence
Protein Sequence
>RC206946 protein sequence
Red=Cloning site Green=Tags(s)

MDLQRPDSYQGGAGPDFNDHVLHKTILVGDSGVGKTSLLVQFDQGKFIPGSFSATVGIGFTNKVVTVDGV
RVKLQIWDTAGQERFRSVTHAYYRDAQALLLLYDITNKSSFDNIRAWLTEIHEYAQRDVVIMLLGNKADM
SSERVIRSEDGETLAREYGVPFLETSAKTGMNVELAFLAIAKELKYRAGHQADEPSFQIRDYVESQKKRS
SCCSFM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_783865
RefSeq Size 3091
RefSeq ORF 648
Locus ID 326624
UniProt ID Q96AX2
Cytogenetics 17q25.1
Summary Rab proteins are low molecular mass GTPases that are critical regulators of vesicle trafficking. For additional background information on Rab proteins, see MIM 179508.[supplied by OMIM, Apr 2006]
Protein Families Druggable Genome, Secreted Protein
Write Your Own Review
You're reviewing:RAB37 (NM_175738) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH304510 RAB37 MS Standard C13 and N15-labeled recombinant protein (NP_001006639) 10 ug
$3,255.00
LC406250 RAB37 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423534 RAB37 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431148 RAB37 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406250 Transient overexpression lysate of RAB37, member RAS oncogene family (RAB37), transcript variant 3 100 ug
$436.00
LY423534 Transient overexpression lysate of RAB37, member RAS oncogene family (RAB37), transcript variant 2 100 ug
$436.00
LY431148 Transient overexpression lysate of RAB37, member RAS oncogene family (RAB37), transcript variant 5 100 ug
$436.00
TP304510 Recombinant protein of human RAB37, member RAS oncogene family (RAB37), transcript variant 2, 20 µg 20 ug
$737.00
TP306946 Recombinant protein of human RAB37, member RAS oncogene family (RAB37), transcript variant 3, 20 µg 20 ug
$737.00
TP328120 Purified recombinant protein of Homo sapiens RAB37, member RAS oncogene family (RAB37), transcript variant 5, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.