RAB37 (NM_175738) Human Recombinant Protein
SKU
TP306946
Recombinant protein of human RAB37, member RAS oncogene family (RAB37), transcript variant 3, 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC206946 protein sequence
Red=Cloning site Green=Tags(s) MDLQRPDSYQGGAGPDFNDHVLHKTILVGDSGVGKTSLLVQFDQGKFIPGSFSATVGIGFTNKVVTVDGV RVKLQIWDTAGQERFRSVTHAYYRDAQALLLLYDITNKSSFDNIRAWLTEIHEYAQRDVVIMLLGNKADM SSERVIRSEDGETLAREYGVPFLETSAKTGMNVELAFLAIAKELKYRAGHQADEPSFQIRDYVESQKKRS SCCSFM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_783865 |
Locus ID | 326624 |
UniProt ID | Q96AX2 |
Cytogenetics | 17q25.1 |
RefSeq Size | 3091 |
RefSeq ORF | 648 |
Summary | Rab proteins are low molecular mass GTPases that are critical regulators of vesicle trafficking. For additional background information on Rab proteins, see MIM 179508.[supplied by OMIM, Apr 2006] |
Protein Families | Druggable Genome, Secreted Protein |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH304510 | RAB37 MS Standard C13 and N15-labeled recombinant protein (NP_001006639) | 10 ug |
$3,255.00
|
|
PH306946 | RAB37 MS Standard C13 and N15-labeled recombinant protein (NP_783865) | 10 ug |
$3,255.00
|
|
LC406250 | RAB37 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC423534 | RAB37 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC431148 | RAB37 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY406250 | Transient overexpression lysate of RAB37, member RAS oncogene family (RAB37), transcript variant 3 | 100 ug |
$436.00
|
|
LY423534 | Transient overexpression lysate of RAB37, member RAS oncogene family (RAB37), transcript variant 2 | 100 ug |
$436.00
|
|
LY431148 | Transient overexpression lysate of RAB37, member RAS oncogene family (RAB37), transcript variant 5 | 100 ug |
$436.00
|
|
TP304510 | Recombinant protein of human RAB37, member RAS oncogene family (RAB37), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP328120 | Purified recombinant protein of Homo sapiens RAB37, member RAS oncogene family (RAB37), transcript variant 5, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.