OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RAB37 (NM_001006638) Human Mass Spec Standard

Be the first to review this product
SKU
PH304510
RAB37 MS Standard C13 and N15-labeled recombinant protein (NP_001006639)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA505311 RAB37 mouse monoclonal antibody, clone OTI2F1 (formerly 2F1) 100 ul
$447.00
LY406250 Transient overexpression lysate of RAB37, member RAS oncogene family (RAB37), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "RAB37 or NM_001006638"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204510
Predicted MW 24.8 kDa
Protein Sequence
Protein Sequence
>RC204510 protein sequence
Red=Cloning site Green=Tags(s)

MTGTPGAVATRDGEAPERSPPCSPSYDLTGKVMLLGDTGVGKTCFLIQFKDGAFLSGTFIATVGIDFRNK
VVTVDGVRVKLQIWDTAGQERFRSVTHAYYRDAQALLLLYDITNKSSFDNIRAWLTEIHEYAQRDVVIML
LGNKADMSSERVIRSEDGETLAREYGVPFLETSAKTGMNVELAFLAIAKELKYRAGHQADEPSFQIRDYV
ESQKKRSSCCSFM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001006639
RefSeq Size 2698
RefSeq ORF 669
Locus ID 326624
UniProt ID Q96AX2
Cytogenetics 17q25.1
Summary Rab proteins are low molecular mass GTPases that are critical regulators of vesicle trafficking. For additional background information on Rab proteins, see MIM 179508.supplied by OMIM, Apr 2006
Protein Families Druggable Genome, Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RAB37" proteins (10)
SKU Description Size Price
PH306946 RAB37 MS Standard C13 and N15-labeled recombinant protein (NP_783865) 10 ug
$3,360.00
LC406250 Lyophilized RAB37 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423534 Lyophilized RAB37 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431148 Lyophilized RAB37 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406250 Transient overexpression lysate of RAB37, member RAS oncogene family (RAB37), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY423534 Transient overexpression lysate of RAB37, member RAS oncogene family (RAB37), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY431148 Transient overexpression lysate of RAB37, member RAS oncogene family (RAB37), transcript variant 5 (as WB positive control) 100 ug
$436.00
TP304510 Recombinant protein of human RAB37, member RAS oncogene family (RAB37), transcript variant 2, 20 µg 20 ug
$737.00
TP306946 Recombinant protein of human RAB37, member RAS oncogene family (RAB37), transcript variant 3, 20 µg 20 ug
$737.00
TP328120 Purified recombinant protein of Homo sapiens RAB37, member RAS oncogene family (RAB37), transcript variant 5, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products