OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

UAP1 (NM_003115) Human Mass Spec Standard

Be the first to review this product
SKU
PH303494
UAP1 MS Standard C13 and N15-labeled recombinant protein (NP_003106)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA307963 Rabbit polyclonal antibody to UAP1 (UDP-N-acteylglucosamine pyrophosphorylase 1)
100 ul
$665.00
LY418892 Transient overexpression lysate of UDP-N-acteylglucosamine pyrophosphorylase 1 (UAP1) (as WB positive control) 100 ug
$436.00

Other products for "UAP1 or NM_003115"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203494
Predicted MW 57.1 kDa
Protein Sequence
Protein Sequence
>RC203494 protein sequence
Red=Cloning site Green=Tags(s)

MNINDLKLTLSKAGQEHLLRFWNELEEAQQVELYAELQAMNFEELNFFFQKAIEGFNQSSYQKNVDARME
PVPREVLGSATRDQDQLQAWESEGLFQISQNKVAVLLLAGGQGTRLGVAYPKGMYDVGLPSRKTLFQIQA
ERILKLQQVAEKYYGNKCIIPWYIMTSGRTMESTKEFFTKHKYFGLKKENVIFFQQGMLPAMSFDGKIIL
EEKNKVSMAPDGNGGLYRALAAQNIVEDMEQRGIWSIHVYCVDNILVKVADPRFIGFCIQKGADCGAKVV
EKTNPTEPVGVVCRVDGVYQVVEYSEISLATAQKRSSDGRLLFNAGNIANHFFTVPFLRDVVNVYEPQLQ
HHVAQKKIPYVDTQGQLIKPDKPNGIKMEKFVFDIFQFAKKFVVYEVLREDEFSPLKNADSQNGKDNPTT
ARHALMSLHHCWVLNAGGHFIDENGSRLPAIPRLKDANDVPIQCEISPLISYAGEGLESYVADKEFHAPL
IIDENGVHELVKNGI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003106
RefSeq Size 2344
RefSeq ORF 1515
Synonyms AGX; AGX1; AGX2; SPAG2
Locus ID 6675
UniProt ID Q16222
Cytogenetics 1q23.3
Summary Converts UTP and GlcNAc-1-P into UDP-GlcNAc, and UTP and GalNAc-1-P into UDP-GalNAc. Isoform AGX1 has 2 to 3 times higher activity towards GalNAc-1-P, while isoform AGX2 has 8 times more activity towards GlcNAc-1-P.UniProtKB/Swiss-Prot Function
Protein Pathways Amino sugar and nucleotide sugar metabolism, Metabolic pathways
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "UAP1" proteins (3)
SKU Description Size Price
LC418892 Lyophilized UAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418892 Transient overexpression lysate of UDP-N-acteylglucosamine pyrophosphorylase 1 (UAP1) (as WB positive control) 100 ug
$436.00
TP303494 Recombinant protein of human UDP-N-acteylglucosamine pyrophosphorylase 1 (UAP1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products