OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

UAP1 (NM_003115) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP303494
Recombinant protein of human UDP-N-acteylglucosamine pyrophosphorylase 1 (UAP1), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA307963 Rabbit polyclonal antibody to UAP1 (UDP-N-acteylglucosamine pyrophosphorylase 1)
100 ul
$665.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "UAP1 or NM_003115"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203494 protein sequence
Red=Cloning site Green=Tags(s)

MNINDLKLTLSKAGQEHLLRFWNELEEAQQVELYAELQAMNFEELNFFFQKAIEGFNQSSYQKNVDARME
PVPREVLGSATRDQDQLQAWESEGLFQISQNKVAVLLLAGGQGTRLGVAYPKGMYDVGLPSRKTLFQIQA
ERILKLQQVAEKYYGNKCIIPWYIMTSGRTMESTKEFFTKHKYFGLKKENVIFFQQGMLPAMSFDGKIIL
EEKNKVSMAPDGNGGLYRALAAQNIVEDMEQRGIWSIHVYCVDNILVKVADPRFIGFCIQKGADCGAKVV
EKTNPTEPVGVVCRVDGVYQVVEYSEISLATAQKRSSDGRLLFNAGNIANHFFTVPFLRDVVNVYEPQLQ
HHVAQKKIPYVDTQGQLIKPDKPNGIKMEKFVFDIFQFAKKFVVYEVLREDEFSPLKNADSQNGKDNPTT
ARHALMSLHHCWVLNAGGHFIDENGSRLPAIPRLKDANDVPIQCEISPLISYAGEGLESYVADKEFHAPL
IIDENGVHELVKNGI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 56.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003106
Locus ID 6675
UniProt ID Q16222
Cytogenetics 1q23.3
RefSeq Size 2344
RefSeq ORF 1515
Synonyms AGX; AGX1; AGX2; SPAG2
Summary Converts UTP and GlcNAc-1-P into UDP-GlcNAc, and UTP and GalNAc-1-P into UDP-GalNAc. Isoform AGX1 has 2 to 3 times higher activity towards GalNAc-1-P, while isoform AGX2 has 8 times more activity towards GlcNAc-1-P.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Protein Pathways Amino sugar and nucleotide sugar metabolism, Metabolic pathways
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "UAP1" proteins (3)
SKU Description Size Price
PH303494 UAP1 MS Standard C13 and N15-labeled recombinant protein (NP_003106) 10 ug
$3,360.00
LC418892 Lyophilized UAP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418892 Transient overexpression lysate of UDP-N-acteylglucosamine pyrophosphorylase 1 (UAP1) (as WB positive control) 100 ug
$436.00

file-alt Citations

Enteric neurons modulate colorectal cancer cell cycle through a PCSK1 - Methionine-Enkephalin Axis
Seika, Puttapaka, Hong et al
bioRxiv (2026)
AI Summary: OriGene’s recombinant human PCSK1 protein (Cat. No. TP303494) was used in this study to functionally assess the role of PCSK1 in modulating colorectal cancer cell proliferation during co-culture experiments with enteric neurons.
Snippet: rs. During this co-culture period, pharmacologic modulation of PCSK1 activity was performed using the PCSK1 inhibitor Decanoyl-RVKR-CMK (Tocris Bioscience, Cat. No. 3501) and recombinant human PCSK1 (OriGene, Cat. No. TP303494). Decanoyl-RVKR-CMK was used at a final concentration of 50 μM, which served as the standard working concentration for all experiments reported in the
FigureFigureFigure
GLUL mediates FOXO3 O-GlcNAcylation to regulate the osteogenic differentiation of BMSCs and senile osteoporosis
Zhang, Qi, Li et al
Cell Death Differ (2025)
Cited by 19
AI Summary: OriGene products—TRIM25 (NM_005082) Human Recombinant Protein, Glutamine Synthetase (GLUL) (NM_002065) Human Recombinant Protein, and UAP1 (NM_003115) Human Recombinant Protein—were used in this study to investigate the molecular interactions and mechanisms underlying GLUL-mediated regulation of osteogenic differentiation in BMSCs relevant to senile osteoporosis.
Snippet: Chloroquine (HY-17589A) were obtained from MedChemExpress LLC (New Jersey, USA). TRIM25 (NM_005082) Human Recombinant Protein, Glutamine Synthetase (GLUL) (NM_002065) Human Recombinant Protein and UAP1 (NM_003115) Human Recombinant Protein were obtained from OriGene (Maryland, USA). Biacore Series S Sensor Chip CM5 were obtained from Cytiva (Washington, D.C. USA)
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products