PSMA4 (NM_002789) Human Mass Spec Standard

CAT#: PH302786

PSMA4 MS Standard C13 and N15-labeled recombinant protein (NP_002780)

Product Images

Coomassie blue staining of purified PSMA4 protein (Cat# TP302786). The protein was produced from HEK293T cells transfected with PSMA4 cDNA clone (Cat# RC202786) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202786
• Predicted MW: 29.5 kDa
• Protein Sequence:
  Sequence Link

  >RC202786 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNE
  DMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWD
  KHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNKTMDVSKLSAEK
  VEIATLTRENGKTVIRVLKQKEVEQLIKKHEEEEAKAEREKKEKEQKEKDK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002780
• RefSeq Size: 1235
• RefSeq ORF: 783
• Synonyms: HC9; HsT17706; PSC9
• Locus ID: 5685
• UniProt ID: P25789
• Cytogenetics: 15q25.1
• Summary: This gene encodes a core alpha subunit of the 20S proteosome, which is a highly ordered ring-shaped structure composed of four rings of 28 non-identical subunits. Proteasomes cleave peptides in an ATP- and ubiquitin-dependent manner. [provided by RefSeq, Aug 2016]
• Protein Families: Druggable Genome, Protease
• Protein Pathways: Proteasome